KEGG   Klebsiella pneumoniae 342: KPK_3931Help
Entry
KPK_3931          CDS       T00772                                 

Gene name
mtnD
Definition
(GenBank) aci-reductone dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00270  Cysteine and methionine metabolism
kpe01100  Metabolic pathways
Module
kpe_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KPK_3931 (mtnD)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     KPK_3931 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     KPK_3931 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ACI06814
UniProt: B5XZU4
Position
3974255..3974797
Genome map
AA seq 180 aa AA seqDB search
MSALTFFSVTDPQTPLWHSTDAKAIQDQLNAKGVRFERWQADRDLGANPSPETVIAAYQH
AIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
EVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaacttttttttccgtgaccgatccgcaaacaccgctctggcacagcacc
gacgccaaagcgattcaggatcaacttaacgccaaaggcgtccgcttcgagcgctggcag
gccgaccgtgacctcggcgcaaatcccagcccggaaacggtcattgccgcctatcagcat
gcgattgataaactggtcgccgaaaagggctatcagagctgggacgtcatcagcctgcgc
gccgataacccgcaaaaagaggcgctgcgggaaaaattcctcaacgagcacacccatggc
gaagacgaggtgcggttttttgtcgagggcgccggcctgttctgcctgcatattggcgac
gaggtgttccaggtactgtgcgaaaagaacgatctgatttcggttcccgcccacaccccg
cactggtttgatatgggttcagaaccgaacttcaccgccattcgcatttttgataacccg
gaaggctggatcgcccagtttaccggtgacgatatcgccagcgcctacccgcggctggcg
taa

DBGET integrated database retrieval system