KEGG   Klebsiella pneumoniae 342: KPK_4032Help
Entry
KPK_4032          CDS       T00772                                 

Gene name
nfnB
Definition
(GenBank) oxygen-insensitive NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00633  Nitrotoluene degradation
kpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    KPK_4032 (nfnB)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     KPK_4032 (nfnB)
  1.-  
   1.-.-  
    1.-.-.-  
     KPK_4032 (nfnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ACI11577
UniProt: B5Y045
Position
4088720..4089373
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALKRYSTKAFDATKKLTASEAEQLKTLLQYSPSSTNSQPWHFIVASTDEGKARV
AKAASGTYVFNERKILDASHVVVFCAKTAMDDAWLQRVVDQEEADGRFATPDAKAANHKG
RTFFADMHRKELKDDDQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGVDFAILDEEFDLKA
QGYTSLVVVPVGHHSVEDFNATLPKSRLPQSTTITEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtatcggtcgctttaaagcgctattccaccaaggcctttgacgccacgaaa
aagctgactgccagcgaagccgaacagctgaaaacgctgctgcagtacagcccgtctagc
accaactcccagccgtggcactttatcgtcgccagcaccgatgaagggaaagctcgcgta
gccaaagccgccagcggcacctacgtgttcaacgaacgcaaaattctcgacgcctcgcac
gtggtggtgttctgcgcgaaaaccgcgatggacgacgcctggctgcagcgtgtggtggat
caggaagaggccgatggccgtttcgccaccccggacgcaaaagccgctaaccacaagggt
cgtaccttctttgccgatatgcaccgcaaagagctgaaagatgacgatcagtggatggcg
aagcaggtgtatctcaacgtcggcaatttcctgctgggcgtggcggcgatgggcctcgac
gccgtgccgatcgaaggggtcgattttgcgatcctcgatgaggaatttgacctgaaagcc
cagggctacaccagcctggtggtggtcccggttggccaccatagcgtggaagatttcaac
gccaccctgccgaagtcgcgtctgccgcagtcgacgaccattaccgagatttaa

DBGET integrated database retrieval system