KEGG   Klebsiella pneumoniae 342: KPK_5440Help
Entry
KPK_5440          CDS       T00772                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00561  Glycerolipid metabolism
kpe00640  Propanoate metabolism
kpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPK_5440 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    KPK_5440 (gldA)
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     KPK_5440 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ACI09967
UniProt: B5XZ24
Position
5508461..5509564
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGAGAIKRLGDYLKPLAERWLVVGDKFVLGFAEEMLHKSLADAGLAAE
IAPFGGECSHNEINRLRDIAGSAKCTAVLGIGGGKTLDTAKALAHFMKVPVAIAPTIAST
DAPCSALSVIYTDEGEFDSYLMLPHNPNMVIVDTQIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAEQHVVTPALERVVEANTYL
SGVGFESGGLAAAHAIHNGMTAIPDAHHYYHGEKVAFGTLTQLVLENAPVDEIETVAALC
HSVGLPITLAQLDIKGDIPTKMRLVAEAACAEGETIHNMPGGVDSDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattattcaatcaccaggcaaatacattcagggcgcaggcgccatcaagcgc
ctcggcgactatctgaagcctctggccgaacgctggctggtagtcggcgataagttcgta
ctggggtttgcggaagagatgctgcataaaagcctggccgacgctggcctggcggccgaa
attgcgccgtttggcggtgagtgttcgcataatgaaatcaatcgcctgcgcgatatcgcc
ggcagcgcgaagtgcaccgccgtgctggggatcggcggtggtaaaacgctggataccgcg
aaagcgctggcccattttatgaaggtgccggtggcgatcgcccccaccatcgcctccacc
gatgcgccgtgtagcgcgctgtcggtgatttacaccgacgaaggggagttcgacagctac
ctgatgctgccgcacaaccccaacatggtcattgtcgatacgcagattgttgccggtgcg
ccagctcgcctgctggccgccgggattggcgatgcgctggccacctggttcgaagcccgc
gcctgctcccgtagcggcgccaccaccatggcgggtgggaaatgcactcaggcggcgctg
gcgctggccgagctgtgctacaacaccttacttgaagagggtgaaaaagcgatgctggcc
gccgaacagcacgtggtcaccccggcgctggagcgagtggtggaagccaacacctacctg
agcggcgtcggctttgaaagcggcggcctggcggcggcgcacgcgattcacaacggcatg
acggccatccctgacgcccaccactattatcacggggaaaaagtggcgttcggtaccctg
acgcagctggtgctggaaaatgcgccggtggacgaaatagagaccgtcgccgcgctgtgc
cacagcgttgggctgccgatcaccctggcgcagctggacatcaaaggtgatatcccgacc
aaaatgcgcctggtggcggaagccgcctgcgctgaaggcgaaaccattcacaatatgccg
ggcggcgtcgactcagaccaggtctacgccgcgctgttggtggccgaccaatacggtcag
cgcttcctgcaggaatgggaataa

DBGET integrated database retrieval system