KEGG   Kosmotoga pacifica: IX53_05985Help
Entry
IX53_05985        CDS       T03949                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kpf  Kosmotoga pacifica
Pathway
kpf00260  Glycine, serine and threonine metabolism
kpf01100  Metabolic pathways
kpf01110  Biosynthesis of secondary metabolites
kpf01120  Microbial metabolism in diverse environments
kpf01130  Biosynthesis of antibiotics
kpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IX53_05985
Enzymes [BR:kpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     IX53_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKI97440
UniProt: A0A0G2Z788
Position
complement(1287293..1288321)
Genome map
AA seq 342 aa AA seqDB search
MKWIDIRSDTVTKPTEEMRLAMYRAEVGDDVYGDDPTVNRLEELAAEMMGKEAALFVPSG
TFGNQLAILTHTDMGNEVIIPDSNHIFIHEVGASAVIASVQLRTLESPDGMPELGRIESA
IRSNDVHFPETGLICMENAHSSGRVLPLEYLKSVKALAGRYSVPVHLDGARIFNAAITLG
VKAKEIAATADSVMFCLSKGLAAPVGSILAGSKKFIEKARKGRKLMGGGMRQVGILAAAG
IVALEKMVDRLEEDHRNARLLAELLSEIKGLKVLEDRLDINMVFFTLEFPEPQVVVEEMK
KRGIKINPPEGKEYRFVTNNDVTTKDIHRVVTVLKEIVEDFS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatcgacataagaagcgatactgttaccaaaccaacggaagagatgcgcctg
gcaatgtatagagccgaggtgggggatgatgtttatggagacgacccaaccgtgaaccgg
cttgaagagcttgccgccgaaatgatgggtaaagaggctgctctttttgtgccatccggt
acatttggaaaccaacttgctatattaacacacactgatatgggaaatgaagttatcatt
ccggattcgaaccatatcttcatacatgaagtgggagcatcggcagttatcgcttcagta
cagcttcgcactctggagagtcctgatggcatgcctgaattaggaagaattgaaagtgcc
atcagatccaacgatgtacacttccctgagactggtcttatctgcatggagaatgcacat
tcttctggtcgtgttctgccactggagtacctgaagtctgtcaaagcccttgcgggtaga
tattcagttcctgtccatctggacggtgcaaggatcttcaatgcggctataactttagga
gtaaaagcaaaagaaatagctgcaacggcagactctgtaatgttctgtttgtcgaaagga
ttggctgctccggtgggctcaatattggctgggtctaagaagtttatcgaaaaagcacgt
aaaggaagaaaactaatgggtggtggaatgaggcaagtcggaatactcgccgcagcgggc
atagtcgcccttgaaaagatggttgaccgtttagaagaagaccatcgaaatgcgagatta
ttggctgaattattgagtgaaataaaggggctcaaagtactcgaagataggctggacata
aatatggtcttcttcaccctggagtttccagagccacaggttgtggttgaagaaatgaaa
aaacggggcatcaaaattaatcctccggaaggaaaggaatatcgcttcgtgacaaataat
gatgttacaacaaaggacattcacagagtggtgacagttcttaaagaaattgtagaagac
tttagttga

DBGET integrated database retrieval system