KEGG   Kosmotoga pacifica: IX53_10205
Entry
IX53_10205        CDS       T03949                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
kpf  Kosmotoga pacifica
Pathway
kpf00472  D-Arginine and D-ornithine metabolism
kpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    IX53_10205
Enzymes [BR:kpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     IX53_10205
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AKI98139
UniProt: A0A0G2ZF28
Position
2134711..2135082
AA seq 123 aa
MAEMRKDDFLQRSKHLQNMTDEELDRYFWELAEKIVDPLIELARTHTSPSIERSVLLRMG
FNSLEAKAIVEKVFDFGLLGKGAGHIVYRTAKELGKPILETGRELASGQHWEIVERLFKG
VEE
NT seq 372 nt   +upstreamnt  +downstreamnt
atggctgaaatgaggaaggatgacttccttcagagaagtaagcacctgcaaaatatgacc
gatgaagaactcgatagatatttctgggaactggcagagaagatagtagatcctctaata
gaactggccagaacacatacaagcccctcaatagagcgttcggtattactcagaatggga
ttcaatagccttgaggcaaaggccatcgttgaaaaagtgtttgatttcggtctgttggga
aagggagccggacatatcgtttacagaacggcaaaagagctgggaaaaccgattctcgaa
actggtagagaactcgcttctggtcagcactgggagatcgttgaaaggctcttcaaagga
gtggaagaatga

DBGET integrated database retrieval system