KEGG   Kosmotoga pacifica: IX53_10210
Entry
IX53_10210        CDS       T03949                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
kpf  Kosmotoga pacifica
Pathway
kpf00472  D-Arginine and D-ornithine metabolism
kpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    IX53_10210
Enzymes [BR:kpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     IX53_10210
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AKI98368
UniProt: A0A0G2ZHW6
Position
2135082..2137274
AA seq 730 aa
MLNPNEKLKIEEILKDLEYYRPRRRGWSWRKQLPKGTKVGPFEYDQISEPLKNSVPLPAA
HYFGNIDPQPDVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHMDGLIEGTP
EGIGGIPITRKQLRATRKALDIIEDEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQD
PQYNVLYRGINPIRSFVDAAVAKRIMAWADMLQIDGAHNANASAKMAWKVMPELLVQHAI
NCAFSIKAGMKKENIALSTVPPVVSPAPEFKMNFIYALTVRELFKGFKFRAQMNTRYIES
DLFDATRIHVLDTLISRLTKADLQSTITPDEGRNVPWHVNSIRGVETAKHTLLALDGIKD
LLKVNEEVVRPKIRELKMRAILFMEEILENGGYFEAVEKGFFVDNGYYPERLGDGIARPK
DGGIGAGSVVSRDPDYFAPVCEHFGYNNLPEGLEKPCDLIGGCTFHKPEKIQFIDELDER
DNVYLRMEKVVKERDEGLMSPEVEWWGDGWIQLDMTIPDDEAHAEAAAIAIARKLGLQEP
TVISKTLLHPSEGTYVELKARVPFKVRRDELTLPEKPKTLPEEEISEFISRYPMKVVAGT
AGNDEHSVGLREILDIKHGGIEKFGIKYTYLGTSVPPEKFIDAAIETGADAILISTIITH
NDVHVENMKKIHQLAIEKGIRDKIILIAGGTQINNDLAVSCGMDAGFGRGTKGIYVASFL
VKRKRELIGE
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgctgaacccgaatgaaaaactgaaaattgaggagatcttgaaagatctggagtactat
aggcccaggagaaggggctggagctggcgaaaacaacttccaaaaggtactaaagttggg
ccatttgagtacgatcagatctccgaacctttgaagaacagtgttcctttaccggctgcg
cattactttggaaatattgatccacagcccgatgtcgttataacctctgaaatagcatcc
ggaaggttcgaagatgacattagacgaatgcgtatggctgcctggcacggagcggatcat
atcatggtgatccgtacactcggacagagccatatggatggactcatcgagggaacacct
gaaggtatagggggtatcccgataacgagaaaacaactacgcgccacgcgaaaagccctc
gacatcattgaagacgaagttggcaggcccattaactttcacagttatgtgagcggagtc
gctggaccagagatcgctgtgctattcgctgaggaaggtgtcaatggcgcccatcaggat
ccccaatataacgtgctgtacaggggaattaacccgatacgttcctttgttgacgcggcc
gtcgcaaagaggataatggcctgggcagatatgttacagatagatggtgcacacaacgcc
aatgcatcggcgaaaatggcatggaaagtaatgccagaacttctggttcaacatgccatc
aactgtgcattttctattaaagctggaatgaaaaaagaaaacattgccctatcaaccgtt
ccgcctgtagtctctcctgcgcctgaattcaaaatgaatttcatctatgccctcactgtt
agagaactattcaaagggtttaaattcagggcacagatgaatacccggtatatcgagtca
gatctcttcgatgcgacgaggatacacgtcctcgatacattgatttccagattgaccaag
gccgatcttcaatcgacgatcaccccggatgaaggtagaaatgtaccctggcacgttaat
tctataagaggagtagaaacggctaaacacaccctgctcgcccttgatgggataaaggac
ctgttaaaagtgaacgaggaggttgtaagacctaaaatccgagaactcaaaatgcgtgca
atactgtttatggaagagattctcgaaaacggagggtattttgaagcggtagaaaagggc
ttcttcgtcgataatggttattatccggaaaggttgggcgatggaatagccagacccaaa
gatggtggtattggagctggtagtgtcgtctccagagatccagattattttgcccctgtt
tgtgaacatttcggttacaacaacctgcccgaaggactcgaaaaaccttgtgatcttatt
ggaggctgtacgttccacaaacccgaaaaaatccaattcatcgacgagttagatgaacgg
gacaacgtatacctcaggatggaaaaggttgttaaggaacgcgatgaaggccttatgagc
ccagaagttgaatggtggggtgacggttggatccaactggatatgactattccagatgat
gaggcgcatgctgaggcagcagcaatcgccatcgccagaaagcttggccttcaggagccc
acggtgataagcaaaacgctgcttcatccgagtgaggggacatatgtggaactgaaggcg
agggtgccattcaaggtacggcgcgatgaactcacactgccggaaaagcccaaaacttta
ccggaagaagagataagtgagttcatttctcgataccctatgaaagtagtggcgggtact
gccggtaacgacgaacattccgtcgggttgagagagatactggatataaagcacggaggt
atcgaaaaattcggtatcaagtacacttaccttggcaccagtgtcccgccagaaaaattt
atcgatgcagcgatcgaaacgggagcagatgcgatccttatttccacgataataacccac
aacgatgtccatgttgaaaatatgaagaagatacaccaactggcaattgaaaagggaatc
agagacaaaatcatactgatagctggtggaacgcagatcaacaacgaccttgccgttagc
tgtggtatggacgcggggtttggacgcggcaccaagggcatttatgttgcaagtttcctc
gtgaaaaggaagagagaactcattggtgaatga

DBGET integrated database retrieval system