KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_12325Help
Entry
KPNIH32_12325     CDS       T03468                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00620  Pyruvate metabolism
kpg00630  Glyoxylate and dicarboxylate metabolism
kpg01100  Metabolic pathways
kpg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH32_12325
   00630 Glyoxylate and dicarboxylate metabolism
    KPNIH32_12325
Enzymes [BR:kpg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     KPNIH32_12325
    1.2.1.22  lactaldehyde dehydrogenase
     KPNIH32_12325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AIW76468
UniProt: A0A2W0XX25
Position
2442652..2444091
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHPMYIDGQFVSGRGDGWIDVLNPATEALLSRIPDGTAEEARLAIDAAERAQPGW
EALPAIERAGWLRKIAAGIRQRADEIAGLIVAEGGKIQQLAAVEVAFTADYLDYMAEWAR
RYEGEIVQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEF
TPNNAIAFAEIVHQVGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVAAGEKIMAA
AAKNITKVCLELGGKAPAIVMDDADLELAVKAVVDSRVINTGQVCNCVERVYVQQGIYDR
FVNRLGEAMKAVQFGDPATRDDIAMGPLINAAARDQVAGKVAKAVAQGARVALGGQPLEG
KGYFYPPTLLLDVRQEMDIIHEETFGPVLPVVAFSTLDEALAMANDSDYGLTSSIYTRDL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLNEYLQTQVVYLQA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccgttcaacacccgatgtatattgatggccagttcgtttccggtcgcggc
gacggctggatcgacgtgcttaacccggcgaccgaagcgctgctgtcgcggatcccggac
gggactgccgaagaggcgcggctggcgattgacgccgccgagcgcgcccagcccggctgg
gaagcgctgccggccattgagcgtgcgggctggctgcgcaaaattgccgccggtatccgc
cagcgtgccgacgagatcgccgggctgattgtcgctgaaggcggcaagatccagcagctg
gcggcggtggaggttgcgttcaccgcggactatctcgactatatggcagaatgggcgcgc
cgttacgaaggtgagatcgtgcagagcgatcgcccgggggagaatatccttgtctttaaa
cgcgcgctgggggtgaccaccgggatcctgccgtggaacttcccgttctttcttatcgcc
cgcaagctggcgccggctctcatcactggaaataccattgtcattaagcccagcgaattt
acgcccaataatgccatcgcctttgccgagattgtccatcaggttgggttgccgaaaggg
gtctttaaccttgtgcttggccgcggagaaaccgttggccaggagctggccggcaatccg
aaggtggcgatggtcagcatgaccggcagcgtggcggcgggagaaaaaattatggccgct
gcggcgaaaaatatcaccaaagtgtgcctcgagctcggcggcaaagcgcctgccattgtg
atggacgatgcggatctggagctggcggtgaaagcggtggtggactcgcgggtgattaac
accgggcaggtgtgtaactgcgtcgagcgggtctatgttcagcagggcatttacgaccgc
ttcgtcaaccgcctcggcgaggcgatgaaggccgtgcagtttggcgacccggcgacgcgg
gatgacatcgcgatggggccgctgatcaacgcggcggcgcgggaccaggtggcgggcaaa
gtggcgaaggcggtggcgcagggggcgcgggtggcgctgggcggtcagccgctggagggc
aaaggctatttttatccgccgaccctgctgctggatgtacgtcaggagatggacattatc
catgaggaaaccttcggtccggtgctgccggtggtggccttttcgaccctcgatgaggcg
ctggcgatggccaatgacagcgattatggcctgacctcctcaatctatacccgcgatctg
aacgtggcgatgaaagcgattaagggactgaagtttggcgaaacctacatcaaccgtgag
aactttgaggcgatgcaggggttccacgccggctggcgtaagtcggggatcggcggggca
gatggccgccacggcctgaatgagtacctgcagacccaggtggtctatctgcaggcctga

DBGET integrated database retrieval system