KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_13430Help
Entry
KPNIH32_13430     CDS       T03468                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00071  Fatty acid degradation
kpg00072  Synthesis and degradation of ketone bodies
kpg00280  Valine, leucine and isoleucine degradation
kpg00310  Lysine degradation
kpg00362  Benzoate degradation
kpg00380  Tryptophan metabolism
kpg00620  Pyruvate metabolism
kpg00630  Glyoxylate and dicarboxylate metabolism
kpg00640  Propanoate metabolism
kpg00650  Butanoate metabolism
kpg00900  Terpenoid backbone biosynthesis
kpg01100  Metabolic pathways
kpg01110  Biosynthesis of secondary metabolites
kpg01120  Microbial metabolism in diverse environments
kpg01130  Biosynthesis of antibiotics
kpg01200  Carbon metabolism
kpg01212  Fatty acid metabolism
kpg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH32_13430
   00630 Glyoxylate and dicarboxylate metabolism
    KPNIH32_13430
   00640 Propanoate metabolism
    KPNIH32_13430
   00650 Butanoate metabolism
    KPNIH32_13430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNIH32_13430
   00072 Synthesis and degradation of ketone bodies
    KPNIH32_13430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNIH32_13430
   00310 Lysine degradation
    KPNIH32_13430
   00380 Tryptophan metabolism
    KPNIH32_13430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPNIH32_13430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNIH32_13430
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH32_13430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpg04147]
    KPNIH32_13430
Enzymes [BR:kpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPNIH32_13430
Exosome [BR:kpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH32_13430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIW76675
UniProt: A0A2S8TG83
Position
complement(2655482..2656672)
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRNTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgttggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgtcagctgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgcggctccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggaaggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcaacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggagcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaacgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtcttgacccggcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtaggcgccagcggtgcgattctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system