KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_18680Help
Entry
KPNIH32_18680     CDS       T03468                                 

Definition
(GenBank) beta-D-glucoside glucohydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00460  Cyanoamino acid metabolism
kpg00500  Starch and sucrose metabolism
kpg01100  Metabolic pathways
kpg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPNIH32_18680
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    KPNIH32_18680
Enzymes [BR:kpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     KPNIH32_18680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like CARDB Ig_GlcNase
Motif
Other DBs
NCBI-ProteinID: AIW77643
UniProt: A0A422W4X2
Position
complement(3751238..3753535)
Genome map
AA seq 765 aa AA seqDB search
MKWLCTVGVAVSLALQPALADELFGNHPLTPQARDAFVTDLLKKMTVDEKIGQLRLISVG
PDNPKEAIREMIKNGQVGAIFNTVTRPDIRVMQDQVMQLSRLKIPLFFAYDVLHGQRTVF
PISLGLASSFNLDAVKTVGRVSAYEAADDGLNMTWAPMVDVSRDPRWGRASEGFGEDTYL
TTMMGQAMVESMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYMPPY
KAGLDAGSGAVMVALNSLNGTPATSDSWLLKDVLRDQWGFKGITVSDHGAIKELIKHGVA
SDPEDAVRVALKSGINMSMSDEYYSKYLPGLVKSGKVTMAELDDATRHVLNVKYDMGLFN
DPYSHLGPKDSDPQDTNAESRLHRKEAREVARESLVLLKNRLDTLPLKKSGTIAVVGALA
DSKRDMMGSWSAAGVADQSVTVLTGIKEALGDNGKVIYAKGANVTDDKGIVDFLNLYENA
VQVDPRSPQEMIDEAVAAAKQSDVVVAVVGEAQGMAHEASSRTDITLPQSQRNLIAALKA
TGKPLVLVLMNGRPLALVKEDQQADALLETWFAGTEGGHAIADVLFGDYNPSGKLPMSFP
RSVGQIPTYYSHLNTGRPYNPEKPNKYTSRYFDEANGPLYPFGYGLSYTTFSVSDVNMSS
ATMPRDGSVTASVQVTNTGNREGATVIQLYLQDVTASMSRPVKMLRGFKKVTLKPGETQT
VSFPIDVDALKFWNQQMKYVAEPGKFNVFIGVDSARVKQSEFELL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggctctgcactgtaggcgtcgccgtgagtctggcgctgcaacccgcgctggcg
gatgaactgtttggtaaccaccccctgaccccgcaggcgcgggatgcctttgtcaccgac
ctgctgaaaaaaatgacggtggacgagaaaatcggccagctgcgtctgataagcgttggc
ccggataacccgaaagaggcgatccgtgaaatgatcaagaacggtcaggtgggggcgatt
tttaacaccgttacccgcccggatatccgtgtgatgcaggatcaggtgatgcagcttagt
cgcctgaagatcccgctgttctttgcctacgatgtgctgcacggtcagcgcaccgtgttt
ccgataagcctcggcctggcctcgtcgtttaaccttgatgcggtgaagaccgtgggccgc
gtgtcagcttatgaagccgccgatgacggcttgaacatgacctgggcgccgatggtcgac
gtctcccgcgacccgcgctggggacgcgcttccgaagggttcggggaagacacctatctg
accacgatgatgggccaggcgatggtggagtcgatgcagggcaagagcccggcggaccgc
tattcggtgatgaccagcgtcaagcatttcgccgcctacggcgcggtagagggcgggaaa
gagtacaacacggtcgacatgagcccgcagcgcctgttcaacgactatatgccgccgtac
aaagccgggcttgatgccggcagcggcgcggtgatggtagccctgaactcgctgaacggc
accccggcgacctctgattcctggctgctgaaagacgtcctgcgcgaccagtggggcttt
aaaggcatcaccgtttccgaccacggcgccatcaaagagttgattaagcacggcgtggcc
tccgacccggaagacgcggtgcgcgtagcgctgaagtccggcatcaacatgagcatgagc
gacgagtattacagcaagtacctgccggggctggtgaagtccggcaaggtgaccatggcc
gagctggatgatgccacccgacacgtgctcaacgtgaaatatgatatgggactgttcaac
gatccctacagccacctgggaccgaaagattctgacccgcaggacaccaatgcggaaagt
cgtctgcatcgtaaagaggcgcgcgaagtggctcgcgagagcctggtgctgctgaagaac
cgtcttgatacgctgccgctgaaaaaatccggcactatcgcggtggttggcgcgctggcg
gacagcaagcgcgacatgatgggcagctggtccgcggccggggtggccgaccagtcggtg
accgtcctgaccggcatcaaagaagcgctgggcgataacggcaaagtgatttacgccaaa
ggggcgaacgttaccgatgacaaaggcattgtcgatttcctcaatttgtatgagaacgcg
gtgcaggttgacccacgctcgccgcaggaaatgatcgacgaagcggtcgcggcggcgaag
caatccgatgtggtggtcgccgtggtgggcgaggcgcagggcatggcgcatgaggcctcc
agccggaccgatatcaccctgccgcagagccagcgcaatctgattgccgctcttaaagcc
accggcaaaccgctggtgctggtgctgatgaacgggcgtccgctggcgctggtgaaagag
gatcagcaagccgatgcgctgctggagacctggtttgctggcaccgaaggcggccacgcc
atcgccgacgtgctgtttggcgactacaacccgtcgggcaagctgccgatgtctttcccg
cgctcggtggggcagatcccaacctactacagccacctgaataccggccggccgtataat
ccggagaagccgaacaagtacacctcgcgttacttcgatgaagccaatggcccgctgtat
ccgtttggttacggcctgagctacaccacctttagcgtctccgatgtcaacatgtcgtcg
gccaccatgccgcgcgatggcagcgtgaccgccagcgtgcaggtgaccaacaccggcaat
cgcgaaggggcgacggtgatccagctctacctgcaggacgtcaccgcctccatgagccgg
ccggtgaaaatgctgcgcggctttaaaaaggtcaccctcaaaccgggcgaaacgcaaacc
gttagcttcccaatcgacgtcgacgcgctgaagttctggaatcagcaaatgaaatacgtt
gctgagccgggcaaattcaatgtctttatcggcgtggactccgcccgcgtgaagcagagc
gagtttgagctgctgtaa

DBGET integrated database retrieval system