KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_22025Help
Entry
KPNIH32_22025     CDS       T03468                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpg03016]
    KPNIH32_22025
Enzymes [BR:kpg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     KPNIH32_22025
Transfer RNA biogenesis [BR:kpg03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    KPNIH32_22025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIW78270
UniProt: A0A1Y0PVK4
Position
complement(4420810..4421604)
Genome map
AA seq 264 aa AA seqDB search
MLEIIYQDDWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIRKRYHAIVRGWLMEEALLDYPLVEELDRIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTSRYGLVELEPKTGRKHQLRRHLAHLRHPILGDSK
HGDLRQNRSAAEHFGCHRLMLHASELSLTHPFTGEPLTLRAGFDDVWMRALSQFGWRGLL
PLNERVEFADDSGQDEENKVNPGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatctaccaggacgactggctggtggcggtcaacaaaccctcgggctgg
ctggtgcatcgcagctggctcgatcgcgacgagaaagtggtggtgatgcagaccgtgcgc
gaccagatcggtcagcacgtttttaccgctcatcgtctcgaccggcccacctccggcgtg
ctgctgatgggattgtcgagcgaggcgggccggctgctggcgcaacagttcgagcagcac
cagatccggaagcgctaccatgcgatcgtccgcggctggctgatggaagaggcgctgctg
gattacccgctggtagaggagctggatagaatcgccgataagttcgcccgcgaagataaa
gggccgcagccagcggtaacccactaccgcggtctggcgacagtggagatgccagtggcg
actgggcgctatcccacctcgcgctatgggctggtggaactggagccgaaaaccggccgc
aagcaccagctgcgccgtcatctggcccacctccgtcatccgatcctcggcgacagcaag
cacggcgatctgcggcaaaaccgcagcgccgcggaacatttcggctgtcaccgcctgatg
ctgcacgccagcgagctgtcgttaacccatccttttaccggcgagccgctgaccctgcgc
gccggttttgacgacgtctggatgcgcgcgctgtcgcagtttggctggcgcgggcttctc
ccgctaaatgaaagggttgagtttgccgacgacagcggtcaggatgaagagaataaggtc
aatccagggagataa

DBGET integrated database retrieval system