KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_22125Help
Entry
KPNIH32_22125     CDS       T03468                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00051  Fructose and mannose metabolism
kpg01100  Metabolic pathways
kpg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPNIH32_22125
Enzymes [BR:kpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KPNIH32_22125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIW78290
UniProt: A0A1Y0PVI4
Position
complement(4443709..4444356)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEDKIVFIDA
DGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLAHEVEVLAQL
YLSTLAITDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaacagactggcccggcagattatcgatacctgcctggaaatgacccgcctg
gggttaaatcaggggaccgccggcaatgtcagcgtgcgctatcagggaggaatgctgatc
acccctaccggtatcccatatgaaaagctgacggaagacaagatcgtctttattgatgcc
gacggccagcatgagcagggaaaactgccctccagcgaatggcgttttcatcaggcggcc
taccagacgcgacccgatgcccaggcggtggtccacaatcacgctgtccattgtacggcg
gtgtcgatcctcaaccggcccatcccggccattcactatatgatcgccgcggccggcggg
aattcgatcccctgcgcgccctatgccaccttcggcacccgcgaactgtctgagcatgtc
gcggtggcgctgaagcaccgcaaagccacgctgctgcagcatcacggcctgatcgcctgc
gaggccagcctggagaaagcgctctggctggcgcatgaagtggaggtcctggcccagctc
tacctcagtacgctggcgattaccgacccggtcccggtgctggatgacgaggcgatcgcc
atcgtgctggagaagttcaaaacctacggattacgcattgaagagtga

DBGET integrated database retrieval system