KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_02425Help
Entry
KPNIH24_02425     CDS       T03369                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KPNIH24_02425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kph02000]
    KPNIH24_02425
Enzymes [BR:kph01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     KPNIH24_02425
Transporters [BR:kph02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    KPNIH24_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_30 SMC_N AAA_23 AAA_16 RsgA_GTPase ABC_ATPase AAA_22 MMR_HSR1 DUF2813 AAA_15 TsaE FeoB_N DUF815 DLIC AAA_27
Motif
Other DBs
NCBI-ProteinID: AID94107
Position
505555..507057
Genome map
AA seq 500 aa AA seqDB search
MSAEAHQEILRTEGLSKFFPGVKALDNVNFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPRRFGLLRRK
EMEARATALMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VEMLFTLMRQLRDNGVSLIFVTHFLDQVYAVSDRITVLRNGSFVGCRETRELPQIELVKM
MLGRELDHNALQRAGRTLLSDKPVAAFEGYGKKGTIAPFDLQVRPGEIVGLAGLLGSGRT
ETAEVIFGIKTADSGKAWIKGKPQTLRSPHQASCLGIGFCPEDRKTDGIIAAASVRENIV
LALQAQRGWLRPIPRREQNEIAERFIRQLGIRTPSAEQPIEFLSGGNQQKVLLSRWLLTK
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIILRDRRQ
VAEIPLAELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaggcacaccaggagatccttcgcaccgaaggacttagtaaattcttcccc
ggcgttaaggcgctggataacgtcaactttagcctgcggcgcggcgaaatcatggccctg
ttgggcgaaaacggcgccggaaaatcgacgctgatcaaagcgctgaccggcgtttaccat
gccgatcgcggcactatctggctggaaggccaggctatttcgcccaaaaataccgcccat
gcccagcagctggggatcggcaccgtctaccaggaagtgaacctgctgcccaatatgtcg
gtggcggataacctgttcatcggccgtgagccgcggcggtttggtctgctgcgacgtaaa
gagatggaggccagggcgacggcgctgatggcctcctacggcttttccctcgacgtgcgc
gagccgctgaaccgcttttcggtggcgatgcagcagatcgtcgctatctgtcgggccatc
gacctgtcggccaaagtgctgatcctcgacgagcccaccgccagcctcgatacccaggag
gtggagatgctgttcaccctgatgcgccagctcagggataacggcgtcagcctgatcttc
gtcacccattttctcgaccaggtctatgcggtcagcgaccgcatcaccgtgctgcgtaac
ggcagcttcgtcggctgccgcgagacccgcgagctgccgcagattgagctggtgaaaatg
atgctgggtcgcgaactggaccacaatgccctgcagcgggcgggccgtaccctgctgagc
gataaaccggtagcggcgtttgaaggctacggtaaaaaaggaaccatcgccccgtttgac
ctgcaggtccgcccgggcgaaattgtaggcctcgccggcctgctgggttccggacgcacg
gaaaccgccgaggtgatcttcggcattaaaacggcggacagcgggaaggcgtggatcaaa
ggcaaacctcagaccctgcgctccccgcatcaggcttcctgcctcgggatcggcttctgt
cctgaagatcgcaaaaccgacggcattatcgccgctgcctcggtgcgggaaaatatcgtt
ctcgccctgcaggcgcagcgcggctggctgcggccgatcccccgccgggagcagaatgag
atcgccgagcgctttattcgccagctggggatccgtaccccgagcgccgagcagccgatc
gagtttctctccggcggcaaccagcagaaggtgctgctctcccgctggctgctgaccaaa
ccgcagttcctgatcctcgatgagccgacccgcggcatcgacgtcggcgcccatgcggaa
attattcgcctgattgaaaccctctgcgccgatggcctggcgctgctggttatctcttct
gaactggaggagctggtgggttacgccgatcgggtcattatcctgcgcgatcgccgacaa
gtggcggagatcccgctcgccgagctctctgttccggcgatcatgaacgctattgcggca
taa

DBGET integrated database retrieval system