KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_03870Help
Entry
KPNIH24_03870     CDS       T03369                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Brite
KEGG Orthology (KO) [BR:kph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    KPNIH24_03870 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Pax2_C
Motif
Other DBs
NCBI-ProteinID: AID94382
Position
complement(803558..803935)
Genome map
AA seq 125 aa AA seqDB search
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattcattcgccccgggtgtgtgtccaggtacagagcgtctatatcgaatcgcagtct
tccccggaagaagagcgctacgtcttcgcttacaccgtcaccattcgcaacctggggcgg
agtcaggttcagctgcttggccgctactggctcatcactaacggccacggtcgtgagact
gaagttcagggtgaaggggtggtcggcgagcaaccgcatattcccgccggcggtgaatat
caatataccagcggcgcagtgattgaaacgccgctgggaaccatgcagggtcattatgag
atgatcgatatcgacggcgcgccgttccgtattgagatccctgttttccgtctcgcagtt
ccaacgctcattcattaa

DBGET integrated database retrieval system