KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_07165Help
Entry
KPNIH24_07165     CDS       T03369                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00052  Galactose metabolism
kph00500  Starch and sucrose metabolism
kph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH24_07165
   00500 Starch and sucrose metabolism
    KPNIH24_07165
Enzymes [BR:kph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPNIH24_07165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AID95009
Position
1469102..1470535
Genome map
AA seq 477 aa AA seqDB search
MTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAREGD
TGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAGFSN
RNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNCE
AMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLTAGA
DLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGAAALTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgcttaat
ctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaacgacccaaac
ggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccgtactccacc
cagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggagcat
ttgccggtagccctggcgccggagggcccggaggataaagacggctgcttttccggctcg
gcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggcgat
cctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacgggatc
cactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccacttccgtgac
ccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgcgaaggcgat
accggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggacgcgggggtg
ctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttcttcaccctc
aacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcggggttcagcaac
cgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccagcgttttatt
cgccatggcgaattccgggagatggataacggccacgatttctatgccccgcaaagcttc
tccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccgctg
ccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctgagc
gcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcctgg
ttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgcgag
gcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcagtatggtctg
cgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctggtgctggaa
cggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccggggcg
gatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtcaatgacggc
gaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaattagcgttattt
gcctggagcggcgcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system