KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_13270Help
Entry
KPNIH24_13270     CDS       T03369                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00071  Fatty acid degradation
kph00072  Synthesis and degradation of ketone bodies
kph00280  Valine, leucine and isoleucine degradation
kph00310  Lysine degradation
kph00362  Benzoate degradation
kph00380  Tryptophan metabolism
kph00620  Pyruvate metabolism
kph00630  Glyoxylate and dicarboxylate metabolism
kph00640  Propanoate metabolism
kph00650  Butanoate metabolism
kph00900  Terpenoid backbone biosynthesis
kph01100  Metabolic pathways
kph01110  Biosynthesis of secondary metabolites
kph01120  Microbial metabolism in diverse environments
kph01130  Biosynthesis of antibiotics
kph01200  Carbon metabolism
kph01212  Fatty acid metabolism
kph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH24_13270
   00630 Glyoxylate and dicarboxylate metabolism
    KPNIH24_13270
   00640 Propanoate metabolism
    KPNIH24_13270
   00650 Butanoate metabolism
    KPNIH24_13270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNIH24_13270
   00072 Synthesis and degradation of ketone bodies
    KPNIH24_13270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNIH24_13270
   00310 Lysine degradation
    KPNIH24_13270
   00380 Tryptophan metabolism
    KPNIH24_13270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPNIH24_13270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNIH24_13270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH24_13270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kph04147]
    KPNIH24_13270
Enzymes [BR:kph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPNIH24_13270
Exosome [BR:kph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH24_13270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AID96178
Position
complement(2778659..2779840)
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPVGSFRGAFAPLSAVDLGAAVVRGLLERCQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREEIVPVSVPQGKKPPRVVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQ
ALQRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRIL
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgccgtacgcaccccggtaggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcagcggtggtgcgcggcctgcttgaacgc
tgccagctgcccgccgcagcggtcgacgaactaattttcggccaggtgcttaccgccggc
tgcgggcaaaacccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtgtgcggctccggactgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgatccaggacggcctgtgggacgcctttaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcggcggccgctatcgccgccgggcgctttcgtgaggagatcgtt
ccggtcagcgtcccgcagggcaaaaagccgccgcgagtcgtgactgacgatgagcaaccg
cgcccggagaccagcgagcagcagctggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcctcgtcgctgaacgacggcgccgcggcggtcctgctg
atgcgcgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccatcggtgatgggcattggcccggtgagcgcctgccgccag
gcgctgcagcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggtcagctgcttgagtgggatagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggcaaccctgtgc
gtcggcggcggccagggcatcgccatgaccctacaacgttaa

DBGET integrated database retrieval system