KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_15460Help
Entry
KPNIH24_15460     CDS       T03369                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00250  Alanine, aspartate and glutamate metabolism
kph00650  Butanoate metabolism
kph00760  Nicotinate and nicotinamide metabolism
kph01100  Metabolic pathways
kph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH24_15460
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPNIH24_15460
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KPNIH24_15460
Enzymes [BR:kph01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     KPNIH24_15460
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     KPNIH24_15460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AID96593
Position
complement(3201594..3202982)
Genome map
AA seq 462 aa AA seqDB search
MMNLSATHAVSVNPTTGEVVSSLPWASEREVDAAIALAAAGYRQWRQTPLADRADALRRI
GAALRARGEEVAQMITLEMGKPIAQARGEVAKSANLCDWYAEHGPAMLATEATLVENNQA
VIEYRPLGAILAVMPWNFPVWQVMRGAVPILLAGNSYLLKHAPNVMGSARLLGEIFAAAG
LPDGVFGWVNATNDGVSQIINDDRIAAVTVTGSVRAGKAIGAQAGAALKKCVLELGGSDP
FIVLNDADLDEAVKAAVTGRYQNSGQVCAASKRFILEAGIAEAFTRKFVDAVAALKMGDP
RDEQNYVGPMARFDLRDELHQQVTATLDEGATLLLGAEKIEGAGNYYAPTVLGNVTAGMT
GFRQELFGPVATLTTARDADHALALANDSEFGLSATVYTTDEAQAQRFARELECGGVFLN
GYCASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKDRR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttatctgcaacgcacgccgtctccgtcaatccgactaccggtgaggtggtc
tcctcgctgccgtgggccagcgaacgcgaggtcgacgcggcgatcgcgctcgccgcggcg
ggctatcgccagtggcgtcagacgccgcttgccgaccgcgccgacgccctgcgccgcatc
ggggccgcgctgcgcgcccgcggtgaagaggtggcccagatgatcacccttgagatgggc
aagccgatcgctcaggcgcgtggcgaggtggcgaaatcggccaacctctgcgactggtac
gctgaacacggcccggcgatgctggcgacggaagctaccctggtggaaaataaccaggct
gtaattgagtatcgtccactgggcgccatactggcggtgatgccgtggaacttcccggtc
tggcaggtgatgcgcggcgcggtgccgatcctgctggccggcaacagctatctgctgaag
catgccccgaacgtgatgggcagcgcccgtctgctgggcgaaatttttgccgccgccggc
ctgccggatggtgtatttggttgggtgaacgccaccaatgacggcgtttcgcagattatc
aatgacgaccgcatcgcggcggtgaccgtcaccggcagcgtccgcgccgggaaggcgatt
ggcgcccaggcgggcgcggcgctgaagaaatgcgtgcttgagctggggggatccgatccc
tttatcgtgctcaacgatgccgatctcgatgaagcggtgaaagccgccgtcaccggccgc
tatcagaacagcggccaggtgtgtgcggcgtcgaaacgctttattctcgaagccggcatt
gccgaggccttcacccgcaaatttgtcgacgccgtggcagcgctgaagatgggcgacccg
cgcgacgagcaaaactacgtcggaccgatggcgcggttcgatttacgcgatgaactgcac
caacaggtaacggcgacccttgatgaaggagcgactctgctgctgggcgcggaaaaaatc
gaaggggcgggcaactactatgcgccaacggtgctgggcaacgtcaccgccgggatgacc
ggctttcgtcaggagctgtttggtccggtagcaaccctgaccaccgctcgcgacgctgac
catgcactggccctcgccaacgacagcgagtttggcctgtccgccacggtctataccacc
gacgaggcgcaggcccagcgctttgcccgcgagctggagtgcggcggcgtcttcctcaat
ggctactgcgccagcgacgcccgcgtggccttcggcggcgtaaagaagagcggttttggc
cgggagctgtcgcattttggcctgcacgagttctgtaatgtgcagaccgtctggaaagac
cgtcgctaa

DBGET integrated database retrieval system