KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_24255Help
Entry
KPNIH24_24255     CDS       T03369                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kph00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    KPNIH24_24255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kph03011]
    KPNIH24_24255
Ribosome [BR:kph03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KPNIH24_24255
  Bacteria
    KPNIH24_24255
  Archaea
    KPNIH24_24255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AID98244
Position
complement(4930200..4930532)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgta
gctgacctgattcgcggtaagaaagtgtcgcaggccctggatattctgacctacaccaac
aaaaaagctgctgtactggtcaagaaggtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgatgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system