KEGG   Kibdelosporangium phytohabitans: AOZ06_10840Help
Entry
AOZ06_10840       CDS       T04088                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00480  Glutathione metabolism
kphy00590  Arachidonic acid metabolism
kphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AOZ06_10840
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AOZ06_10840
Enzymes [BR:kphy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AOZ06_10840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ALG07355
UniProt: A0A0N9HV14
Position
2366662..2367138
Genome map
AA seq 158 aa AA seqDB search
MKITTLDGTATTLDELTGGKVALVVNVASQCGLTPQYTALEHLHEEYGPRGFTVIGVPCN
QFGGQEPGTVEEIQTFCSTTYGVTFPLTEKLEVNGSGKHPLYAELTGHADEDGQAGDVQW
NFEKFLLSAKGDVVARFRPAVEPGDAKVRSAIEAQLPR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcacgaccctggacggcacggccaccacgttggacgagctgaccggtgggaag
gtcgcactggtggtgaacgtggcctcccagtgcgggttgacgccgcagtacaccgcgctg
gagcacctgcatgaggagtacggcccgcgtgggttcaccgtgatcggtgtgccgtgcaac
cagttcggcggccaggagccgggcaccgtggaggagatccagacgttctgctcgaccacg
tacggcgtgactttcccgttgactgagaaactcgaggtcaacggatcgggcaagcacccg
ctgtacgcggagctgaccgggcacgccgacgaggacggccaggccggggacgtccagtgg
aatttcgagaagttcctgctgtcggccaagggtgacgtggtcgcccggttccggcccgcg
gtcgagcccggcgacgcgaaggtccggtcggcgatcgaggcgcagctgccccggtga

DBGET integrated database retrieval system