KEGG   Kibdelosporangium phytohabitans: AOZ06_13950Help
Entry
AOZ06_13950       CDS       T04088                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
kphy  Kibdelosporangium phytohabitans
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOZ06_13950 (pdxA)
Enzymes [BR:kphy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     AOZ06_13950 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     AOZ06_13950 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ALG07871
UniProt: A0A0N7F378
Position
complement(3001326..3002345)
Genome map
AA seq 339 aa AA seqDB search
MTKPVLAVTLGDPAGIGPEITAKTLAAPEATDTARPLAVGDAPVLRRAIEVLGLDAAVNA
VSSVADARFEPGTIDILDLGIAPGDLPWGEVNATAGKAAVAAIEEATRAALRGEVDAVVT
SPINKESIWAAGSKHLGHTEMLGELTGSDRFNTMFWVRGLRIFFATRHLSLRQAVEQITK
PNIEHAIREAYTALRVFGNESPRLAVAALNPHGGEGGKFGDEEIVAIAPAVEAAKADGLD
VSGPIPADSVFHQGLEGRYDGVLSLYHDQGHIASKTVDFHGTVSVTVGLPILRTSVDHGT
AFDIAGTGRAEHGTMVAAFRAAVDLAPYAPRLREAYPGR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcccgtgctcgcggtgacgctcggggatccggccgggatcggaccggagatc
accgcgaagacgctcgccgcgccggaggccacggacaccgcgcgcccgctcgcagtcggc
gacgcgcccgtcctgcgccgtgcgatcgaggtgctcggcctggacgcggcggtcaacgcc
gtgtcgtcggtggccgacgccaggttcgagccaggcacgatcgacatcctcgacctgggc
atcgcgcccggtgacctgccttggggcgaggtgaacgcgaccgcgggcaaggcagccgtc
gccgcgatcgaggaggcgacgagggcggcgctgcgcggcgaagtggacgccgtcgtgacg
tcaccgatcaacaaggagtcgatctgggcggccgggtcgaaacacctcgggcacaccgag
atgctcggcgaactgaccggctccgaccggttcaacaccatgttctgggtccgcggtctg
cggatcttcttcgcgaccaggcacctgtcgctgcgccaggcggtcgagcagatcaccaag
ccgaacatcgaacacgcgatccgcgaggcgtacacggcgttgcgtgtcttcggcaacgag
tcccccagactcgccgtggcagcgctgaacccgcacggcggcgaaggcggcaagttcggt
gacgaggagatcgtcgcgatcgcgcctgcggtcgaagcggcgaaagccgacgggctggac
gtgtccggcccgatcccggcggattccgtgttccaccaaggcctcgaaggccgctacgac
ggtgtcctgtcgctgtaccacgaccaggggcacatcgcgtcgaagaccgtcgacttccac
ggcacggtgtcggtgaccgtcggtttgccgatcctgcgcacgtcggtcgaccacggcact
gccttcgacatcgccggaaccggccgcgccgagcacggcacgatggtggcggcgttccgg
gccgccgtggatctcgcaccgtacgcgccccgcctgcgtgaggcctatcccggcagatga

DBGET integrated database retrieval system