KEGG   Kibdelosporangium phytohabitans: AOZ06_24390Help
Entry
AOZ06_24390       CDS       T04088                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00903  Limonene and pinene degradation
kphy00930  Caprolactam degradation
kphy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AOZ06_24390
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AOZ06_24390
Enzymes [BR:kphy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     AOZ06_24390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 HTH_1 Say1_Mug180 Peptidase_S9 Thioesterase HTH_30 Hydrolase_4 COesterase MarR_2
Motif
Other DBs
NCBI-ProteinID: ALG09622
UniProt: A0A0N9I1U5
Position
5355354..5356532
Genome map
AA seq 392 aa AA seqDB search
MSEHPAELRSVNLPSAADAIELKHLRAFVAVADELNFGRAAARLYVSQSALSRQIQALER
LIGCPLLLRSTHRVELTLAGEALLGAAGPLLADLNDAITLTRAAGGEVSTRLAQLWNAVL
HDGHAGVAQLREAYEALNAQFPVPEATKVRPVQAGGVSALTVSAGTDTLPDFLHLHGGGL
IAGSAFGYRPLAGALAAATGATVLLPDYRLAPEHPFPAGLDDAVAAYRWLLDQGADPGKL
TVGGDSAGGGLAVSLLLRLEQQGLPRPARAVLLCPSVNVVAAPQDTPVARWLSLYSGAHP
RTDPLLSILEADLSGLPPTLVQTGTGDVILHETRRFVDRATEHGANVQLDLYPVSTHVFH
LFWSFLPEAADALEQIGRFLGSTDTTAAAEAG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcaccccgccgagctccggtcggtgaacctgccgtcggccgcggacgcgatc
gagctcaagcacctgcgtgcgttcgtcgcggtggccgacgagctcaacttcggcagggca
gcggcccggctgtacgtgtcgcagtccgcgctcagcaggcagatccaggcgctggaacgg
ttgatcggctgcccgctgctgctgcggtcgacccatcgcgtggagctgacgctcgccggt
gaggcactgctcggcgcggcggggccgttgctggccgacctcaacgacgcgatcaccctc
acccgtgcggcaggcggtgaggtgagcacgcggctcgcgcaactgtggaacgcggtcctg
cacgacggtcatgccggcgtggcacagttgcgcgaggcgtacgaggcactcaacgcgcag
ttcccagtccccgaagcaaccaaggtacgcccggtgcaagccgggggagtgtccgctttg
accgtctcagccggaacggacaccctgccggacttcctgcacctgcacggcggcgggctg
atcgcgggttcggccttcggctaccggccgctggccggagcgctcgcggcggcgaccggt
gcgactgtgctgctgccggactaccgtctcgcgccggaacaccccttcccagccgggctc
gacgacgcggtggctgcctaccgctggctgctcgaccaaggcgcggaccccgggaagctg
accgtgggcggcgactcggcaggcggcgggctcgcggtgtccctgctgctccggctggaa
cagcagggcctgccccgcccggcccgcgcggtgctgctgtgcccgtcggtgaacgtcgtg
gccgcaccgcaggacactcccgtcgcccgctggctttcgctctacagcggtgctcacccg
cgaacggacccgctgctgagcatcctggaagccgacctgtcaggcctgccgccgacgctc
gtccaaaccggcacaggcgacgtgatcctgcacgaaacgcgccgcttcgtcgaccgcgcc
accgaacacggcgcgaacgtccaactggacctctacccggtgagcacgcacgtgttccac
ttgttctggtcgttcctgccggaagccgcggacgcactcgaacagatcggccggttcctc
ggctcgacggacaccaccgccgcggcggaagcgggctga

DBGET integrated database retrieval system