KEGG   Kibdelosporangium phytohabitans: AOZ06_36665Help
Entry
AOZ06_36665       CDS       T04088                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00770  Pantothenate and CoA biosynthesis
kphy01100  Metabolic pathways
Module
kphy_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AOZ06_36665
Enzymes [BR:kphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AOZ06_36665
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     AOZ06_36665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N
Motif
Other DBs
NCBI-ProteinID: ALG15332
UniProt: A0A0N9IFM2
Position
complement(8132825..8134045)
Genome map
AA seq 406 aa AA seqDB search
MLGVGGGIAAYKACEVLRRLTESGHDVQVLPTESALNFVGKATFEALSHNPVYTGVFEDV
PEVAHVRIGKHADLVVVVPATADLLARAAHGNANDMLTGTLLTARCPVLMIPAMHTEMWE
HPATRDNVALLRSRGIVVTEPASGRLTGTDTGKGRLADPVEIVDIARLLLARADALPRDM
EGKRVVVSAGGTREPLDPVRYLGNRSSGKQGYALARVAAQRGAQVTLVSAHTVALPEPAG
VDVVNVGTALELREAMHKAAADADIVVMAAAVADFRPVSLATHKIKKTDQDPDPVALTRN
PDVLRELVVARSDGKFDPYIVGFAAETGDESGDVLTHARAKLARKGCDLLVVNAVGDGKA
FEVEDNAGWLLAADGSERPIALGSKAQMAAGIWDFVMKSSTSRTVG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggggtcggcggaggcatcgccgcctacaaagcctgtgaagtcctgcgccggctg
accgagtccggtcacgacgtgcaggtgctgccgaccgagtcggcgctgaacttcgtcggc
aaggccactttcgaggcgttgtcgcacaaccccgtctacaccggtgtcttcgaggacgtt
cccgaggtggcgcacgtccggatcggcaagcacgccgatctggtcgtcgtcgtccccgcg
accgcggacctgctggccagggccgcgcacgggaacgccaacgacatgctcaccggcacc
ctgctgaccgcgcggtgcccggtgctgatgatcccggcgatgcacaccgagatgtgggaa
caccccgcgacacgcgacaacgtcgcgttgctgcggtcccgcggcatcgtggtcaccgag
cccgccagtggccggctgaccggcaccgacaccggcaaaggccgcctggccgaccccgtc
gagatcgtcgacatcgcccggctgctgctggcccgtgccgacgcgctgccccgtgacatg
gagggcaagcgggtcgtggtgtccgccggcgggacacgcgagccgctggatcccgtccgc
tacctgggcaaccgttcgtcgggcaagcagggctacgccctcgcgcgggttgccgcgcaa
cgcggcgcgcaggtcacgctcgtctcagcgcacacggtcgcgttgcccgaacccgcgggc
gtggacgtcgtgaacgtcggaacggcgctggaactgcgggaagccatgcacaaggccgcc
gccgacgccgacatcgtggtgatggccgccgcggtcgccgacttccggccggtcagcctg
gccacccacaagatcaagaagaccgaccaggaccccgacccggtcgcgctcacccgcaac
ccggacgtgctgcgcgaactcgtcgtcgcccggtcggacgggaagttcgacccgtacatc
gtcgggttcgccgccgagaccggtgacgagagcggcgacgtgctcacgcacgcgcgtgcc
aaactcgcccgcaagggctgcgacctgctggttgtcaacgccgtcggcgacgggaaagcc
ttcgaggtcgaggacaacgccgggtggctgctcgccgcggacggctccgaaaggcctatc
gcactgggttcgaaggcgcaaatggcggccggtatctgggacttcgtcatgaagtcgagc
acttctcgaacggttggctga

DBGET integrated database retrieval system