KEGG   Kibdelosporangium phytohabitans: AOZ06_41530Help
Entry
AOZ06_41530       CDS       T04088                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00260  Glycine, serine and threonine metabolism
kphy01100  Metabolic pathways
kphy01110  Biosynthesis of secondary metabolites
kphy01120  Microbial metabolism in diverse environments
kphy01130  Biosynthesis of antibiotics
kphy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOZ06_41530
Enzymes [BR:kphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AOZ06_41530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ALG12491
UniProt: A0A0N9I958
Position
complement(9312358..9313455)
Genome map
AA seq 365 aa AA seqDB search
MIELRSDTFTLPTAAMRHAMVEAVVGDACYGEDPTVRELEETAAERVGKQAACLMPSGTM
GNLAAVLAHVPRGSKVIAGAESDIYLYEAGGVSMCGGALLAPVPHLPDGRFVPDALAAEF
PGDPDDPQFALPALLCVENTQNRCGGVALPLDYLREVRAFAAARGVGVHLDGARLFNAEV
ASGVPAADIAATADSVQFCLSKGLSAPIGSMVAGSAEFVTRVRRVRKLLGGTMRQAGVVA
AAGLIALREMTGRLAEDHANARRLAEHLADIDGVDIDPGSVGTNIVLFRVLDERLTAAEF
VAAAGRAGVALTEFGHGRIRAVTHRGVIAADIDRAADVLATVLALPRGGETGHEDPRPVR
GGGQQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagcttcgtagcgacacgttcacgctacccactgcggcgatgcggcacgcgatg
gtcgaggccgtggtcggtgacgcctgttacggcgaggacccgaccgtgcgcgaattggag
gagaccgctgccgaacgcgtcggcaagcaggccgcctgcctgatgcccagcggaacgatg
ggcaacctcgccgccgtgctggcccacgtgccccgcgggagcaaggtcattgccggtgcc
gaatccgacatctacctctacgaggcgggcggagtgtcgatgtgcggcggtgcgctgctc
gcccccgtcccgcatctgcccgacgggcggttcgtgcccgacgcgctggcggcggagttc
ccgggcgatccagacgacccgcagttcgcgctgcccgcgttgctgtgtgtggagaacacc
cagaaccgttgtggcggcgtggctctgccgttggactaccttcgtgaggtacgtgccttc
gccgcagcgcgcggtgtcggggtccacctcgacggcgcccggcttttcaacgccgaggtc
gcctccggcgttccggcagccgacatcgccgccaccgcggactcagtccagttctgcctg
tcgaaagggctttccgcgccgatcgggtcgatggtggccggttcggcggagttcgtcacg
cgggtccggcgcgtccgcaagctcctgggcggcaccatgcggcaggcgggtgtggtcgcg
gcggccgggctgatcgcgttgcgggagatgacggggcggctcgccgaggatcacgcgaac
gcgcgcaggctggccgagcacctcgctgacatcgacggcgtcgacatcgatcccggttcg
gtgggcacgaacatcgtcctgttccgagtactcgatgagcgcctcaccgcggcggagttc
gtcgcggcggccggtcgggcaggggtggcgctcaccgaattcgggcacggccggatccgc
gcggtcacccaccggggcgtgatcgccgcggacatcgaccgagcggcggacgtgctcgcc
accgtgctggctttgcctcgcggcggcgagaccgggcacgaggacccacgtcccgtacgc
ggtggtggacagcaatga

DBGET integrated database retrieval system