KEGG   Kibdelosporangium phytohabitans: AOZ06_51980Help
Entry
AOZ06_51980       CDS       T04088                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00520  Amino sugar and nucleotide sugar metabolism
kphy01100  Metabolic pathways
kphy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AOZ06_51980
Enzymes [BR:kphy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AOZ06_51980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALG14271
UniProt: A0A0N7F5H8
Position
11551438..11552580
Genome map
AA seq 380 aa AA seqDB search
MTHLVISGAKVVTPDGVIDPGWLEVENGTITAIGSGHPEQSGVPVTDAAGAWVVPGFVDI
HCHGGGGEAFTDTDPLRIGTAVEAHRRHGTTTMLASLVSRPVPELVNQVAALAELVKDGL
IAGIHLEGPFLSAARCGAHDPAILCPPEPSSIRKLLAAGDGAVSMITIAPELDNAVNAVH
TLVDNGVIAALGHTDATEATVLPAIDAGATVATHLFNGMRPLHHREPGPIGALLDDPRIT
VELIVDLVHVHPTVVRLAARHAGPGRTVLITDAIAAAGVGDGVYDVGGLEVTVTDGVPRI
AGGGSLAGSTLTMDAAFRNLVTGCGLTIREAVTACSTRPAALLGLSEETGSLTVGLAADF
VLLDAELRPTGVMARGEWVK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacctggtgatcagtggggccaaggtcgtgacgcccgacggcgtcatcgatccc
gggtggctggaagtcgagaacggcacgatcaccgcgatcggctcgggtcaccccgagcag
tcaggcgtccccgtgacggacgcggcaggcgcgtgggtcgtgcccggtttcgtcgacatc
cactgccacggtggcggcggagaggcgttcaccgacaccgatccgttgcgcatcggcacg
gcggtcgaggcccatcgcaggcacggcacgacgaccatgctcgcctcgctggtctcacgc
ccggttcccgagctggtcaaccaggtcgccgcactggccgagctggtcaaggacgggttg
atcgcgggcatccacctggagggcccgttcctgtccgcggcccgctgcggcgcgcacgac
ccggccatcctgtgcccgccggagccgtcgtcgatccgcaagctgctcgccgcgggcgac
ggcgcggtcagcatgatcaccatcgcgcccgagctggacaacgcggtcaacgcggtccac
acgctggtcgacaacggggtgatcgcggcgctcgggcacaccgacgcgaccgaggcgacc
gtgctgcccgccatcgacgcgggcgcgaccgtggccacgcacctgttcaacggcatgcgg
ccgttgcaccaccgcgaacccgggccgatcggcgcgctgctggacgacccgcgcatcacg
gtcgagctgatcgtcgacctggtgcacgtgcacccgacggtcgtccggctggcggcgagg
cacgccgggccgggcaggaccgtgctgatcacggacgcgatcgcggccgccggtgtcggt
gacggcgtgtacgacgtgggcgggctcgaggtcacggtgaccgacggggtgccgaggatc
gcgggcggcggatcgctggcaggcagcacgctcaccatggacgcggccttccgcaacctg
gtcaccggctgcgggctgaccatccgcgaggcggtcacggcgtgttcgacgcgaccggcc
gcgctgctgggcctgagcgaggagaccgggtcgctgaccgtgggcctcgcggcggacttc
gtgctgctcgacgccgagctgcggccgaccggtgtgatggcccgcggggagtgggtcaag
tag

DBGET integrated database retrieval system