KEGG   Klebsiella pneumoniae CG43: D364_08675Help
Entry
D364_08675        CDS       T02866                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
kpi00071  Fatty acid degradation
kpi00072  Synthesis and degradation of ketone bodies
kpi00280  Valine, leucine and isoleucine degradation
kpi00310  Lysine degradation
kpi00362  Benzoate degradation
kpi00380  Tryptophan metabolism
kpi00620  Pyruvate metabolism
kpi00630  Glyoxylate and dicarboxylate metabolism
kpi00640  Propanoate metabolism
kpi00650  Butanoate metabolism
kpi00900  Terpenoid backbone biosynthesis
kpi01100  Metabolic pathways
kpi01110  Biosynthesis of secondary metabolites
kpi01120  Microbial metabolism in diverse environments
kpi01130  Biosynthesis of antibiotics
kpi01200  Carbon metabolism
kpi01212  Fatty acid metabolism
kpi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D364_08675
   00630 Glyoxylate and dicarboxylate metabolism
    D364_08675
   00640 Propanoate metabolism
    D364_08675
   00650 Butanoate metabolism
    D364_08675
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D364_08675
   00072 Synthesis and degradation of ketone bodies
    D364_08675
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D364_08675
   00310 Lysine degradation
    D364_08675
   00380 Tryptophan metabolism
    D364_08675
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D364_08675
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D364_08675
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D364_08675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpi04147]
    D364_08675
Enzymes [BR:kpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D364_08675
Exosome [BR:kpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D364_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III HemY_N
Motif
Other DBs
NCBI-ProteinID: AGX37878
Position
complement(1811456..1812646)
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLVSILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRDTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgccaactgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgtggttccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccatggc
gagctggaagatggcctggtctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttt
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggagggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcgacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgctggctgcggggcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaatgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtctcgacccggcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtaggcgccagcggtgcgattctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system