KEGG   Klebsiella pneumoniae JM45: N559_3461Help
Entry
N559_3461         CDS       T02799                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00480  Glutathione metabolism
kpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    N559_3461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpj02000]
    N559_3461
Enzymes [BR:kpj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     N559_3461
Transporters [BR:kpj02000]
 Other transporters
  Pores ion channels [TC:1]
   N559_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_N_4 GST_C_3 Tom37 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AGT25112
Position
3516167..3516793
Genome map
AA seq 208 aa AA seqDB search
MITLWGRNNSTNVKKVRWVLEELDLPYQQILAGLEFGLNHDPEYLAMNPNGLVPLLKDDA
TGVVVWESNTIIRYLAAQYGVDRLWLAAPAQRAQGEKWMDWSNGTLSPAHRPVLMGLVRT
PPEQRDPAAIAAGISACEALFAMLDDELAKMPWLSGEQFGLGDIAVAPFVYNLLSILDSW
QPRPHLQRWYQQISQRPAWREVVQIPVT
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattacactgtggggacgtaataactcgaccaacgtgaagaaagtacgctgggtgctg
gaggagctggatctgccttatcagcagatcctcgccgggctggagtttggtctcaaccat
gacccggaatatctggcgatgaacccgaacgggctggtgccgctgttaaaggacgatgcc
accggggtggtagtgtgggaatcaaatacgattattcgctacctggcggcccagtatggc
gttgaccgtctgtggcttgccgcgccggcgcagcgcgcgcaaggggaaaagtggatggat
tggtccaacggcaccctctcacccgcccatcgcccggtattaatgggcctggtgagaacg
ccgccggagcagcgcgacccggcggccatcgccgcggggatcagcgcctgcgaagcgctg
ttcgccatgctggatgacgaactggccaaaatgccgtggctctccggcgagcagttcggc
cttggcgatattgccgtcgctcccttcgtctacaatctgttgtcgatcctcgacagctgg
caaccgcggccccatctgcagcgctggtatcagcagattagccaacgtcctgcctggcgc
gaagtagtgcagatcccggtgacctga

DBGET integrated database retrieval system