KEGG   Klebsiella pneumoniae JM45: N559_3834Help
Entry
N559_3834         CDS       T02799                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00052  Galactose metabolism
kpj00500  Starch and sucrose metabolism
kpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    N559_3834
   00500 Starch and sucrose metabolism
    N559_3834
Enzymes [BR:kpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     N559_3834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N LacI Peripla_BP_3 Peripla_BP_4 Peripla_BP_1 Glyco_hydro_43 HTH_10 HTH_26 TetR_N
Motif
Other DBs
NCBI-ProteinID: AGT25470
Position
3910102..3912534
Genome map
AA seq 810 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGIFDHGPLHELDSGFEFYAPQTMQADDGRRLLVGWMGV
PDGDEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELVALRGEAQGWCGQTLPLAPM
ELAFDMPQQHAGAGLCRRPAAHRQSRRSASVAPRPADGGDASPLLARRGAPPADLYRPLQ
RRDFHQRWRRGDEQPLLPGLSGAAHLQRCDAGGILPLAAAAMHGRISVLLSGSRVLMKTK
RVTIKDIAELAGVSKATASLVLNGRGKELRVAQETRERVLAIAREQHYQPSIHARSLRDN
RSHTIGLVVPEITNYGFAVFSHELETLCREAGVQLLISCTDENPGQESVVVNNMIARQVD
GLIVASCMHSDADYQKLSEQLPVVLFDRFPSDSALPLVMTDSVTPTAELISRIAPQHADE
FWFLGGQPRLSPSRDRLAGFTQGLAQAGITLRPEWVINGNYHPSSGYEMFAALCARLGRP
PKALFTAACGLLEGVLRYMSQHHLLDSNIHLASFDDHYLYDSLSLRIDTVQQDNRQLAWH
CYDLLSQLIDGQAPEPLQRYLPATLQIRHP
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgtctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcaacggactgctgaac
gatcctaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgcgaccatacctataagtgctggggacactggagctctgccgatctgctgcac
tggcggcacgaacctatcgccctgatgccggatgaagagtatgaccgcaacggctgctac
tctggcagcgcggtcgagttcgagggtgccctgactctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgcaccgcctggcaatgtctggcgaccgagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctgccagaaggctataccggccatgtgcgcgac
cctaaagtgtggcggcaggacgggcgctggtacatggttcttggggcgcaggatgtgcaa
cagcgcggcaaagtgctgctgtttaccgccagcgacctgcgggagtggcgcctggtgggc
gagatcgccgggcacgacgtgaacggcctggcgaacgccggctacatgtgggagtgcccg
gatctctttccgctggcggacacccacctgctgatctgctgcccgcaggggctggcccgc
gaagcgcagcgctttctcaatacctatccggcggtgtggatggcaggccgcttcgacgcc
gaacgcgggatcttcgaccacggcccgctgcacgagctggacagcggatttgagttctac
gcgccgcagaccatgcaggccgacgatggccgccgcctgctggtcggctggatgggcgtc
cccgacggggacgagatgcatcagcccacccgcgcgcagggctggatccatcagatgacc
tgcgtgcgtgagctggagtggcaggctggcactctgtatcagcgtccgctgcgcgagctg
gtcgccctgcgcggggaagcccagggctggtgcggacagaccctgcccctcgccccgatg
gagctggcctttgacatgccccaacagcacgctggggctggactttgccggcgccctgca
gctcaccgtcaatcgcgacggtctgcgtctgtcgcgccgcggcctgcagacggcggagat
gcatcaccgctactggcgcggcgaggcgcgccgcctgcggatctttatcgaccgctccag
cgtagagattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggcta
tccggggcagctcatcttcagcggtgcgacgccggtggcattctgccgctggctgctgcg
gccatgcatggtagaataagcgttttgctttcaggctcccgggtgctgatgaaaaccaaa
cgcgtaactatcaaagatatcgccgaactggcgggcgtctccaaagcgaccgccagcctg
gtactcaacggtcgtggtaaagagctgcgcgtggcgcaggagacgcgcgagcgcgtactg
gcgatcgctcgcgaacagcactatcagccgagcattcacgcgcgctcgctgcgcgataac
cgcagccataccattggtctggtggtgccggagatcaccaactacgggtttgccgttttc
tcccacgagcttgagacgctctgccgggaagccggcgtgcagctgcttatctcctgcacc
gacgaaaacccaggccaggagagcgtggtggtcaataacatgatcgcccgccaggtcgac
ggcctgatagtcgcctcttgtatgcacagcgatgccgactatcagaaactcagcgaacag
ctgccggtggtgctgtttgaccgcttccccagcgacagcgccctgccgctggtgatgacc
gactcggtcaccccaacggccgagctgatctcccgtatcgcgcctcagcatgcggacgag
ttctggtttctcggcggccagccgcggctgtcgccgtcgcgcgaccggctggcggggttc
acccagggcctggcccaggcggggatcacgctgcgccctgagtgggtgatcaacggcaac
taccaccccagctccggctatgagatgttcgcggcgctctgcgcgcggctggggcgtccg
ccgaaggcgctcttcaccgcggcctgcgggctgctcgaaggggtgctgcgctatatgagc
cagcatcatctgctggattccaatattcatctcgccagcttcgacgatcactatctgtat
gattcgctttccctgcgcattgataccgtgcagcaggataatcgccagctggcctggcac
tgctacgatctgctcagccagctgatcgacggtcaggccccggagccgcttcagcgctac
ctgcccgccaccctgcagattcgccatccctga

DBGET integrated database retrieval system