KEGG   Klebsiella pneumoniae JM45: N559_4736Help
Entry
N559_4736         CDS       T02799                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00564  Glycerophospholipid metabolism
kpj01100  Metabolic pathways
kpj01110  Biosynthesis of secondary metabolites
Module
kpj_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    N559_4736
Enzymes [BR:kpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     N559_4736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AGT26327
Position
4830464..4831426
Genome map
AA seq 320 aa AA seqDB search
MLNDLKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMKEAQKPDTAAY
RTFNDFFVRPLRDDVRPLNTDPNVLVMPADGVISQLGAIENDKILQAKGHDYSLEALLAG
NYQMADLFRNGSFATTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWSGTVTPPREGIIKRWTWPAGDNEGSIA
LLKGQEMGRFKLGSTVINLFAPGQVKLVDTLQSLSVTKIGQPLATAVEATAAAEPAPLPE
EEIRAEHRASPLVDDKQDQG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaacgatcttaaactttcactgcaatacattctgcctaaactgtggctcacccgc
ctcgcaggctggggtgcgagcaaacgcgcaggttggctgacgaagctggtcatcgatctg
ttcgtgaaatactacaaggtcgatatgaaagaggcgcagaagccggataccgcggcttat
cgcaccttcaacgatttcttcgtgcgcccgctgcgcgacgacgttcgcccgctgaatacc
gatccaaacgtgctggtgatgccggccgatggcgtgatcagccagcttggcgccattgag
aacgataaaatcctgcaggctaaaggtcatgactacagtctggaagccctgctggccggc
aactatcagatggccgacctgttccgtaacggcagcttcgccaccacctacctgtcgccg
cgcgactatcaccgcgtacatatgccgtgcaacggcatcctgcgcgaaatgatctacgtt
cctggcgacctgttctctgttaaccacttgacggcgcagaacgtcccgaacctgttcgcc
cgtaacgagcgcgtcatctgcctgtttgatactgagtttggcccgatggcgcaaattctg
gtgggcgcaactatcgtcggcagcattgagaccgtgtggtccggcaccgtgaccccgccg
cgcgaaggcattattaaacgctggacctggcccgctggcgacaacgaaggctccatcgcc
ttgctgaaaggccaggagatgggccgcttcaaactgggttccaccgtgatcaacctgttt
gccccgggccaggtgaagctggtcgacacgctgcaaagcctgtccgtgaccaagatcggc
caaccgctggcgacagcagtggaagcgaccgccgccgctgaacccgcgccgttaccggaa
gaagagatccgcgccgaacaccgcgccagcccgctggttgacgataaacaagatcaaggt
taa

DBGET integrated database retrieval system