KEGG   Klebsiella pneumoniae JM45: N559_4896Help
Entry
N559_4896         CDS       T02799                                 

Definition
(GenBank) PTS enzyme IIAB, mannose-specific
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00051  Fructose and mannose metabolism
kpj01100  Metabolic pathways
kpj02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    N559_4896
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    N559_4896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpj02000]
    N559_4896
Enzymes [BR:kpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     N559_4896
Transporters [BR:kpj02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    N559_4896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AGT26480
Structure
PDB: 

Position
4993776..4994270
Genome map
AA seq 164 aa AA seqDB search
MQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPPGMKVNVV
SLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAV
SLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINETAFCE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaccctcgcccgtattgatgaccgactgattcatggccaggtcaccaccgtg
tggtcaaaagtcgccaacgcccagcggataattatctgcaatgacgatgtatttaacgat
gaggttcgccggaccctgttgcgccaggcggctccgccaggcatgaaggtaaacgttgtc
agtctggaaaaagcggttgcggtctatcataacccgcaatatcaggacgagaccgtcttt
tatttatttaccaatccacacgatgttttaacgatggtgcgccagggcgtgcagatcgcc
acgttaaatattggtggcatggcctggcgacccggtaaaaaacagctaaccaaagccgtt
tctttggatccgcaggatattcaggcattccgtgaactcgataaactgggcgtaaaactc
gatttacgcgtggtcgcatcagatccgtcagtcaatattctcgacaaaattaacgaaaca
gctttctgcgaataa

DBGET integrated database retrieval system