KEGG   Klebsiella variicola KP5-1: A593_03005Help
Entry
A593_03005        CDS       T03368                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
kpk  Klebsiella variicola KP5-1
Pathway
kpk00020  Citrate cycle (TCA cycle)
kpk00620  Pyruvate metabolism
kpk01100  Metabolic pathways
kpk01110  Biosynthesis of secondary metabolites
kpk01120  Microbial metabolism in diverse environments
kpk01200  Carbon metabolism
Module
kpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A593_03005
   00620 Pyruvate metabolism
    A593_03005
Enzymes [BR:kpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     A593_03005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AID99566
UniProt: A0A087FPU8
Position
complement(648919..650553)
Genome map
AA seq 544 aa AA seqDB search
MNKKMAVPRSQAVGPNSTRTNTRHEQETDVLLIGGGIMSATLGTWLQELEPDWSITMVEQ
MSSVAEESSNGWNNAGTGHAALMELNYTPQTANGINIDKAVDINEAFHISRQFWAHQVTR
GVLNKPKSFINSVPHMSFVWGEDNVNFLRARYAALQQSELFRGIRYSEDHQQIKAWAPLV
MEGRDPQQKVAATRTEVGTDVNYGEITRQLIAGLQKHDNFSLQLGTVVRRFKRNADKSWT
VTLADADNRRQKRVIKAKFIFIGAGGAALTLLQETGIPQAKEYAGFPVGGQFLVCENPEV
VNHHLAKVYGQAEVGAPPMSVPHIDTRIIDGKRVVLFGPFATFSTRFLKNGSLWDLLAST
NTSNILPMLNVGLDNFDLVKYLISQVMQKDKDRLAALCEYYPEARKEDWRLWQAGQRVQI
IKRDAKKGGVLRLGTEVVSDDEGTVAALLGASPGASTAAPIMLQLMEKVFKDKVNSPEWQ
ARLKAIIPTYGIRLDGNPAEIEKALAWTSEVLELKYEPAAVADEAPQAELKPLSGGKPMA
DIAL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaagatggccgtaccacgctcacaggcggttggtcccaacagcactcggacc
aacacccgccatgagcaagagacggatgtattgttgattggcggcggcattatgagcgcc
acactgggaacctggctgcaggagcttgagccagactggtctattaccatggttgagcag
atgtccagcgtggcggaagagagctcaaacgggtggaacaatgcgggtaccggccacgcg
gcgctaatggagctgaactacacgccgcagaccgccaacggcatcaatatcgacaaagcg
gtcgacatcaacgaagccttccatatctcgcgtcagttctgggcgcatcaggtgacgcgc
ggcgtcctgaacaaaccaaaatctttcattaacagcgtgccgcacatgagctttgtgtgg
ggcgaagataacgtcaacttcctgcgcgcgcgctatgcggcgctgcagcagagcgaactg
ttccgcggtattcgctattctgaagaccatcagcagatcaaagcctgggcgccgctggta
atggaaggccgcgatccgcagcaaaaggtggccgccacccgtactgaagtgggaaccgac
gtcaactatggcgaaattacccgccagctgatcgccggcctgcaaaagcatgataatttc
tccctgcagctgggtaccgtggtacgtcgcttcaagcgcaacgccgacaagagctggacg
gtcactctcgcggatgccgacaaccgtcgtcagaagcgggtcattaaagcgaaattcatc
tttatcggcgccggcggcgcggcgttgacgctgctgcaggaaaccggcattccacaggcc
aaagagtatgcgggcttcccggtcggcggccagttcctggtctgcgaaaatccggaggtg
gtgaaccaccatctggcgaaggtttacggccaggccgaagtgggcgcgccgccgatgtcg
gtgccgcacattgatacccgtattatcgacggtaaacgcgtggtgctgttcgggccgttc
gccaccttctcgacccgcttcctgaagaacggttcattgtgggatctgctggcctcgacg
aatacctcgaatattctgccgatgctcaacgtcggtctggacaacttcgatctggtgaaa
tacctgattagccaggtgatgcagaaagataaagatcgcctggcggcgctgtgcgagtac
tatccggaagcgcggaaagaggactggcggttgtggcaggccggtcagcgcgtgcagatt
atcaagcgcgatgcgaagaagggcggggtactgcgcctcggtactgaagtggtgagcgat
gacgaaggcactgtcgcggcgctgctcggcgcatcgccaggcgcctccaccgcggcgcct
atcatgctgcagctgatggaaaaagtgtttaaagacaaagtcaattcgccggaatggcag
gccaggctgaaggccatcatcccgacctacggtattcgccttgacggcaacccggcggag
attgagaaagcgctggcgtggaccagtgaagtgctggagctgaaatatgagccggccgcg
gtggcggatgaagccccgcaggcggagctgaagccgctgagcggtggtaagccgatggcg
gatatcgcgctctga

DBGET integrated database retrieval system