KEGG   Klebsiella pneumoniae subsp. pneumoniae KP5-1: A593_06480Help
Entry
A593_06480        CDS       T03368                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpk  Klebsiella pneumoniae subsp. pneumoniae KP5-1
Pathway
kpk00071  Fatty acid degradation
kpk00072  Synthesis and degradation of ketone bodies
kpk00280  Valine, leucine and isoleucine degradation
kpk00310  Lysine degradation
kpk00362  Benzoate degradation
kpk00380  Tryptophan metabolism
kpk00620  Pyruvate metabolism
kpk00630  Glyoxylate and dicarboxylate metabolism
kpk00640  Propanoate metabolism
kpk00650  Butanoate metabolism
kpk00900  Terpenoid backbone biosynthesis
kpk01100  Metabolic pathways
kpk01110  Biosynthesis of secondary metabolites
kpk01120  Microbial metabolism in diverse environments
kpk01130  Biosynthesis of antibiotics
kpk01200  Carbon metabolism
kpk01212  Fatty acid metabolism
kpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A593_06480
   00630 Glyoxylate and dicarboxylate metabolism
    A593_06480
   00640 Propanoate metabolism
    A593_06480
   00650 Butanoate metabolism
    A593_06480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A593_06480
   00072 Synthesis and degradation of ketone bodies
    A593_06480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A593_06480
   00310 Lysine degradation
    A593_06480
   00380 Tryptophan metabolism
    A593_06480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A593_06480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A593_06480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A593_06480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpk04147]
    A593_06480
Enzymes [BR:kpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A593_06480
Exosome [BR:kpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A593_06480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIE00203
Position
complement(1347288..1348466)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVLKALVEQTGIDPQSVDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAWAL
SSQHKARKAIDSGRFRDEIVPVITEHNGAARTVDTDEQPRVDASAEGLASLQPTFDRLGS
VTAGNASSINDGAAAVMMMSEAKALELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWRLDDVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtcgtgatcgtcggggcgctgcgaacgccgattggctgctttcagggcgcc
ttatcgcgccattcagccgtcgagctggggagtgtggtattgaaagcgctggttgagcag
acagggatcgatccgcagagtgtggatgaggtgatcctcggccaggtgctgaccgccggt
accgggcaaaaccccgcgcgccagtccgcaattcgcggcgggctgcctaacactgtatcg
gccattaccataaacgacgtctgcggctccggcctgaaggctttgcacctcgccacccag
gcgattcagtgcggggaagcggatgtggtgatcgccggcggccaggagaacatgagccgc
gctccgcatgtactcaccgacagccgcaccggcgcccagttgggcaatagccagctgatt
gacagcctggtgcatgacggactgtgggatgccttcaacgattatcatatgggcgttacg
gcggaaaacctcgcccgggaatacggcatcagccgcgagttgcaggacgcctgggcgctc
agctcacagcataaggcgcgcaaggcgattgattccggccgctttcgcgacgagattgtc
ccggttattaccgagcataacggcgcggcgcgcaccgtggataccgatgaacaaccgcgg
gtggatgccagcgcggaagggttggccagcctgcagcctaccttcgaccgcctcgggtcg
gtgaccgccggcaacgcctccagcatcaacgacggcgcggcggcggtgatgatgatgagt
gaagccaaagcccttgaactggggctgccgatcctcgcccggatccgcgccttcgccagc
gtcggggtcgatccggcgctgatgggcattgccccggtgcacgccacccgtcgctgtctt
gagcgggccggctggcggctggacgacgtcgatctgatcgaagccaatgaggcctttgcc
gctcaggcgatctcggttggccgggtactggagtgggatgaacggcgggtcaacgtcaac
ggcggcgcgatcgctctcggccaccccatcggcgcctccggctgccggatcctggtatcg
ctggtgcatgaaatgatcaagcgtgatgcccgtaaagggctggcgacgctgtgcatcggc
ggcggtcagggcgtggcgctggcggtagagcgcgcctga

DBGET integrated database retrieval system