KEGG   Klebsiella variicola KP5-1: A593_10025Help
Entry
A593_10025        CDS       T03368                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
kpk  Klebsiella variicola KP5-1
Pathway
kpk00540  Lipopolysaccharide biosynthesis
kpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A593_10025 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kpk01005]
    A593_10025 (rfaD)
Enzymes [BR:kpk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     A593_10025 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:kpk01005]
 Unusual sugar
  A593_10025 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short
Motif
Other DBs
NCBI-ProteinID: AIE00869
UniProt: A0A0B7G2S5
Position
2054964..2055896
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MAGEEFGEIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVADVNLWFWENGVSGIFNLGTGRA
ESFQAVADATLAFHKKGSIEYIPFPDKLKGRYQAFTQADLTNLRKAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcaggctttatcggcagcaacatcgttaaagcgctgaat
gacaaaggcatcaccgacattctggttgtcgacaatctgaaagacggcaccaagtttgtg
aatctggttgacctgaacatcgctgactacatggataaagaagactttctgatccagata
atggcgggtgaagagttcggtgaaatcgaagcgatcttccacgaaggcgcgtgctcttcc
accaccgagtgggatggcaagtacatgatggataacaactatcagtactctaaagagctg
ctgcactactgcctggagcgtgaaatcccgttcctgtacgcctcttccgccgccacctac
ggcgggcgcaccagcgacttcatcgagtcccgtgagtacgaacagccgctgaacgtctac
ggctactccaaattcctgttcgacgaatacgtccgccagatcctgccggaagccaattcg
cagatcgtcggcttccgctacttcaacgtctacgggccgcgcgaaggccacaaaggcagc
atggcgagcgtcgctttccacctcaacacccagctgaataatggcgaaagtccgaaactg
ttcgaaggcagcgacggcttcaagcgcgacttcgtctacgtgggcgacgtggcagacgtc
aacctgtggttctgggaaaacggcgtgtccgggatcttcaaccttggcaccggccgcgcg
gaatccttccaggcggttgccgatgcgaccctggctttccataaaaaaggcagcattgag
tacatcccgttcccggacaaactgaaaggccgctaccaggcattcacccaggccgatctg
actaacctgcgcaaagcgggctatgacaaaccgttcaaaaccgttgccgaaggcgtaacg
gaatatatggcctggctgaatcgggatgcgtaa

DBGET integrated database retrieval system