KEGG   Klebsiella pneumoniae subsp. pneumoniae KP5-1: A593_21990Help
Entry
A593_21990        CDS       T03368                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpk  Klebsiella pneumoniae subsp. pneumoniae KP5-1
Pathway
kpk00071  Fatty acid degradation
kpk00072  Synthesis and degradation of ketone bodies
kpk00280  Valine, leucine and isoleucine degradation
kpk00310  Lysine degradation
kpk00362  Benzoate degradation
kpk00380  Tryptophan metabolism
kpk00620  Pyruvate metabolism
kpk00630  Glyoxylate and dicarboxylate metabolism
kpk00640  Propanoate metabolism
kpk00650  Butanoate metabolism
kpk00900  Terpenoid backbone biosynthesis
kpk01100  Metabolic pathways
kpk01110  Biosynthesis of secondary metabolites
kpk01120  Microbial metabolism in diverse environments
kpk01130  Biosynthesis of antibiotics
kpk01200  Carbon metabolism
kpk01212  Fatty acid metabolism
kpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A593_21990
   00630 Glyoxylate and dicarboxylate metabolism
    A593_21990
   00640 Propanoate metabolism
    A593_21990
   00650 Butanoate metabolism
    A593_21990
  Lipid metabolism
   00071 Fatty acid degradation
    A593_21990
   00072 Synthesis and degradation of ketone bodies
    A593_21990
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A593_21990
   00310 Lysine degradation
    A593_21990
   00380 Tryptophan metabolism
    A593_21990
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A593_21990
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A593_21990
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A593_21990
Enzymes [BR:kpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A593_21990
Exosome [BR:kpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A593_21990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF1853
Motif
Other DBs
NCBI-ProteinID: AIE03075
Position
4604579..4605784
Genome map
AA seq 401 aa AA seqDB search
MNKVYIVAACRTPVGRFLGALKTVSAVELAALTVRHNLQQAGIDPAWIDEVICGSVLSAG
QGMGPARQVALRAGIPVQKPAYTLNMICGSGMKSITEGAIHIQSGYADLVVAGGMENMSQ
APFLLRGEIRGGMKFGAFSSEDLIQSDGLTDPLLHIPMGETAEAIAAHEQISRAEQDQYA
LDSHQKASAASRAGHFAEEIVPVTVSAKRGVSVVREDEQIRHDLSADQLAALKPAFRRDG
SVTAGNASGLNDGAASVILASARAVAQYGLRPLAEIVSFGEGGVDPAMMGLGPLPAMTCA
LRRGRFQLSDMARLEINEAFAAQVLGVVKGLAREHQMTAEEIAARLNVNGGAIALGHPLG
SSGTRIVVSLLHALRRENKPTGLASLCIGGGMGIALIVKAI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtgtatatcgtcgcggcctgccgtacgccggtggggcgttttcttggcgcc
ctgaaaacggtctctgcggtggaactggccgcgctcaccgtccgccacaacctgcagcag
gccgggattgacccggcgtggattgacgaagtgatctgcggcagcgtcctctctgccggg
caggggatggggccggcgcgtcaggtcgcgctgcgggcggggatcccggtgcaaaagccg
gcttacaccctgaatatgatctgcggtagcggcatgaaaagtattaccgagggggcgatc
catatccagagcggttatgccgacctggtcgtcgctggcgggatggaaaacatgagccag
gcgccgtttttgctgcggggagagataaggggcggcatgaaatttggcgcgttcagcagc
gaggatctgatccagagcgatggcttaaccgatccgctgttgcatattccgatgggggaa
acggcggaggccatcgccgcgcatgagcagatctcgcgcgcagaacaggaccagtacgcc
ctcgacagccatcaaaaagcctccgccgccagccgcgccggccattttgccgaggagata
gtgccggtgacggtcagcgcgaagcggggcgtcagcgtggtccgcgaggatgagcagatc
cgccatgaccttagcgccgaccagctggcggcgctgaaaccggcttttcgtcgtgacggg
agcgtcaccgcgggcaacgcctcggggctgaacgacggcgcggcgtcagtgatcctcgcc
tcggcgcgcgccgttgcgcagtacggcctgcggccgctggctgagatagtctccttcggc
gagggcggcgtcgacccggcgatgatggggcttgggccgctgccggccatgacgtgcgcc
ctgcgccgcgggcggtttcagctcagcgatatggcgcgactggaaattaacgaagccttt
gccgcgcaggtgctgggggtggtcaaggggctggcccgcgagcatcagatgacggcggag
gagatagccgcccgcctgaacgtcaacggcggcgcgattgccctcgggcacccgctcggc
agttccggaacccggattgtcgtgagccttctgcacgcgctgcgtcgggagaataaaccg
accggcctggcctcgctgtgtatcggcggcgggatgggtattgcgttaattgtgaaagcg
atctga

DBGET integrated database retrieval system