KEGG   Klebsiella variicola KP5-1: A593_26080Help
Entry
A593_26080        CDS       T03368                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kpk  Klebsiella variicola KP5-1
Pathway
kpk00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A593_26080
Enzymes [BR:kpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A593_26080
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A593_26080
    1.1.1.-  
     A593_26080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AIE03794
Position
pKp5-1:complement(48501..49466)
Genome map
AA seq 321 aa AA seqDB search
MKAVRLYGIREVKIEHSAPPTLKSGWARVQVHAAGICGSDLHNFITGKWFSRLPVTPGHE
LFGVIAEINESESLFRVGMRVVADSRVWCGSCFFCLAGENNLCEELGFVGEVFDGGFAEE
VILPLQNLLIVPDSVPDDIAVLSEPLGVALRVINQLNPSAGDTVCVAGGGTIGGLTALLL
SRLKKCRVQLLEPNKQRYQLLSSVIGLSPPGTFSFAVEASGHPAALIDLLSSIRSGGRIA
LVGIFQHSKGLDLNKVVEKEITLIGCSVFQDEQNEALQVMASLAEDLRKLIAPPITLDEL
PDAYMSLISGDSHYLKTVTNQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtacgcttatatggtatcagggaagttaaaatagagcattctgctccaccg
acgttaaaatcgggatgggctagagttcaagtacatgctgcgggaatatgcggatctgat
ttacacaatttcataaccggtaaatggtttagccggttgcctgttacgcccggtcacgag
ttgttcggagtgattgctgaaattaacgaaagcgaaagtctattcagagtcggtatgcgc
gtcgtcgctgattctcgggtatggtgtggaagttgctttttttgccttgccggggaaaat
aacctctgtgaagaactaggctttgtcggtgaagtattcgatggcggattcgctgaagaa
gtgatacttcccctacaaaacttactgattgtccctgatagtgttcctgatgatatcgcc
gtgctgagtgagcctctgggtgttgcactccgggtgattaatcaactgaacccatctgca
ggtgacacggtttgtgtagctggtggggggacgataggcggcttaaccgcattactgctt
agccggctaaaaaaatgccgggttcagctactggaacctaataaacagcgttatcaatta
ctctcatcagttattggcctttcaccgcccggcacattttcattcgccgttgaagcttcc
ggacacccggccgcgctcattgatctcctgagtagtatcaggtctggtggacgcattgcc
ctcgtgggtatttttcaacattcgaaggggctggatcttaataaggtagttgaaaaagag
attactcttattggctgtagtgtgttccaagatgaacagaatgaggcattgcaggtaatg
gcttcactggcggaggatttaagaaagctgattgcgcctcccattactcttgatgagcta
ccggatgcctatatgtctctcatctcaggagactctcactatctcaaaacggtgaccaat
caatga

DBGET integrated database retrieval system