KEGG   Kocuria palustris: KPaMU14_04395Help
Entry
KPaMU14_04395     CDS       T04045                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kpl  Kocuria palustris
Pathway
kpl00450  Selenocompound metabolism
kpl00970  Aminoacyl-tRNA biosynthesis
kpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KPaMU14_04395
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KPaMU14_04395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpl01007]
    KPaMU14_04395
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpl03016]
    KPaMU14_04395
Enzymes [BR:kpl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KPaMU14_04395
Amino acid related enzymes [BR:kpl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KPaMU14_04395
Transfer RNA biogenesis [BR:kpl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KPaMU14_04395
 Prokaryotic type
   Other AARSs
    KPaMU14_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ALB02928
Position
993324..994898
Genome map
AA seq 524 aa AA seqDB search
MSAETPEPETVTSARPAFYLTTAISYPNGAPHIGHAYEAIAADVLARFKRLDGYDVRFLT
GTDEHGQKMQQTADREGIAPKQLADRNAAAFRSMDDMLQVSYDRFIRTTDADHYEASQEI
WRRMEANGDIYLDSYSGWYSVRDEAYYAEDETEVVDGVRLSKGTGTELTWTAESSYFFRL
SAYQDRLLALYEDGLVGPQSRSNEVAEFVRGGLRDLSISRTTFDWGVPVPGDPDHVMYVW
VDALTNYLTGVGYPDVDGELFQKFWPADVHIIGKDIIRFHSVYWPAFLMSAGLPVPRKVF
GHGFLFNQGEKMSKSVGNVIDPQSLVSAYGLDALRFFLMREVPFGQDGSYSHEAIVSRID
SDLSNDLGNLAQRSLSMVAKNLEGRAPQPGELTAEDRQILDDAHALLPQVREAFDALQFH
RGLEQIWKVVAQCNRYFSSQEPWVLRKTDPERMATVLWSTLEVVRTVAVLVQPVMPGSAA
RLLDALGQEAQDREFTALSRELVPGAPLPKPTPVFPRYEEPSKE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgagacccccgagcccgagaccgtgaccagcgcgcgaccggcgttctacctc
acgaccgccatctcgtaccccaatggggcgccgcacatcgggcacgcctacgaggccatc
gccgcggatgtcctggcccggttcaagcgcctggacggctatgacgtccgcttcctgacc
ggcaccgacgagcacggccagaagatgcagcagaccgccgaccgcgagggcatcgcgccc
aagcagctcgccgatcgcaacgcggccgcgttccggtccatggacgacatgctccaggtc
tcctacgaccgcttcatccgcaccacggatgcggatcactacgaggcctcgcaggagatc
tggcggcgcatggaggccaacggggacatctacctggactcgtactcggggtggtactcg
gtgcgcgacgaggcctactacgccgaggacgagaccgaggtcgtcgacggcgtgcgcctg
tccaagggcactggcacggagctgacctggaccgcggagtcctcctacttcttccggctc
tccgcctatcaggaccgtctgctggccctctacgaggacgggctggtgggcccgcagtcg
cgcagcaacgaggtcgctgaattcgtgcgcggcggactgcgcgacctgtcgatctcgcgg
accaccttcgactggggcgtccccgtgcccggggacccggatcacgtcatgtacgtgtgg
gtggacgccctgaccaactacctgacgggtgtgggctacccggatgtcgacggcgagctc
ttccagaagttctggccggcggacgtgcacatcatcggcaaggacatcatccgcttccac
tcggtctactggccggccttcctgatgtcggccggactgccggtcccgcggaaggtcttc
gggcacggctttctgttcaaccagggcgagaagatgtccaagtccgtgggcaacgtgatc
gacccgcagtcgctggtcagcgcctacggcctcgacgccctgcgcttcttcctcatgcgc
gaggtccccttcggacaggacggctcgtactcgcacgaggcgatcgtctcgcgcatcgat
tcggacctgtcgaatgacctcggcaacctggctcagcgctcgctgtccatggtggccaag
aacctcgagggtcgcgccccgcagccgggcgagctcacggccgaggaccgccagatcctc
gacgacgcccacgccctgctgccgcaggtccgcgaggccttcgacgcgctccagttccat
cgcggtctggagcagatctggaaggtcgtggcgcagtgcaaccgctacttcagctcgcag
gagccgtgggtgctgcgcaagaccgatcccgagcgcatggccacggtgctgtggtccacg
ctcgaggtcgtgcgcacggtcgcggtgctggtccagcccgtcatgcccggatcggccgca
cgcctgctcgacgcgctcgggcaggaagcgcaggaccgcgagttcaccgcgctgtcgcgc
gagctcgtgcccggcgcaccgctgcccaagcccacgccggtcttcccgcgctacgaggag
ccctcgaaggagtga

DBGET integrated database retrieval system