KEGG   Kocuria palustris: KPaMU14_09505Help
Entry
KPaMU14_09505     CDS       T04045                                 

Definition
(GenBank) GlcNAc-PI de-N-acetylase
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
kpl  Kocuria palustris
Brite
KEGG Orthology (KO) [BR:kpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPaMU14_09505
Enzymes [BR:kpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     KPaMU14_09505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ALB04456
Position
complement(2177845..2178768)
Genome map
AA seq 307 aa AA seqDB search
MRLLAVHAHPDDESSKGAATMAHYRRLGVDVMVVTCTGGESGSILNSAMESVPHARRDLA
GYRRQEMDRAAKALDIRHRWLGYTDSGLPEGDPLPPLPPACFALQPVDRAAAPLIQLVRE
FRPHVILTYDENGGYPHPDHIQTHNVAMRAWEKAGEPEHLPELGEAWQPLKLYYDRAFDL
DRLQALHAALTAKGLESPFAERIARRLEARDTEGNDSAPNEHVTTTKIHCADCFPVRDEA
LRAHATQVAPESWFFAMSPQDQAAAWPWEDYVLADTRVDAELPETCVFTGIVDEVHPDPE
DAPSWQI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctggccgtccacgcccatcccgacgacgaatcgtcgaagggcgccgccacg
atggcgcactaccgccgtctgggcgtcgacgtgatggtcgtgacctgcaccggcggcgag
tccggctcaatcctcaactccgccatggagtccgtgccccacgcccggcgcgacctcgcg
ggctaccgccgccaggagatggaccgggcggccaaggcgctggacatccgccaccgctgg
ctcggctacacggactccgggctgcccgagggcgatccgctgccgccgctgccgccggcg
tgcttcgcgctgcagccggtggaccgggccgccgccccgctgatccagctggtccgcgag
ttccgcccgcacgtgatcctcacctacgacgagaacggcggctatccgcacccggatcac
atccagacccacaacgtcgccatgcgcgcgtgggagaaggcaggggaacccgagcacctg
ccggagctgggcgaggcctggcagccgctgaagctctactacgaccgcgccttcgacctg
gatcgcctccaggcgctacacgcggccctgaccgccaagggcctggagtccccgttcgcc
gagcgcatcgcgcgtcggctcgaggcccgggacacggagggcaacgactccgcgccgaac
gagcacgtcaccacgaccaagatccactgcgccgactgcttcccggtgcgcgacgaggcc
ctgcgggcgcatgcgacccaggtggccccggagtcgtggttcttcgccatgtccccacag
gaccaggccgcggcctggccgtgggaggactacgtgctcgccgacacccgcgtggacgcc
gagctgccggagacctgcgtgttcaccgggatcgtggacgaggtccacccggaccccgag
gacgccccctcctggcagatctga

DBGET integrated database retrieval system