KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_01470Help
Entry
KPHS_01470        CDS       T01733                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00860  Porphyrin and chlorophyll metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
Module
kpm_M00121  Heme biosynthesis, glutamate => heme
kpm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPHS_01470
Enzymes [BR:kpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KPHS_01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 11845128
NCBI-ProteinID: YP_005224447
UniProt: A0A0H3GGJ2
Position
complement(167300..168040)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEALVSRLRAMGRVAWSFPLIEFTPGRELPALGDALARLGPDDLLFALS
QHAVEFAHARLQQQGLPWPTSPRYFAIGRTTALALHTVSGQHIHYPLDREISEVLLQLPE
LQNIAGKNALILRGNGGRELLGATLTERGARVTFCECYQRSAKHYDGAEEAMRWQSRGVT
TLVVTSGEMLQQLWSLIPQWYREQWLLHCRVVVVSERLALQARELGWQEIQVADSADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcactcgtccactaccgcaaggagaagcgctggtcagccgtctgcgg
gccatgggacgcgtggcctggagctttccgctgatagaatttacgcccggcagggagctt
cccgcgctgggcgatgcgcttgcccgactggggcccgacgatctgctatttgcgctatcc
cagcatgcggtggaattcgcccatgcccgtctgcagcagcagggcctgccctggcccact
tctccgcgctattttgccattggccgcacgacggcgctggccctgcatacggtcagtggg
cagcatatccattatccgttagatcgggaaattagcgaagtcttgctacaattacctgaa
ttacaaaacattgccgggaaaaatgcgctgatcctacgcggcaatggcgggcgggaactc
ttaggcgcgacgctgaccgagcgcggcgccagggtcacattttgtgaatgttatcaacgt
agtgcaaaacattacgatggcgcagaagaagcgatgcgctggcaatctcgcggagtcacc
acgctggtggtcaccagcggcgagatgctgcagcagctatggtcgttaataccgcaatgg
tatcgcgaacagtggctcctgcactgccgcgttgtcgttgtcagcgaacgtctggccctt
caggcccgggaactgggctggcaggagattcaggttgccgatagcgccgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system