KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_06810Help
Entry
KPHS_06810        CDS       T01733                                 

Definition
(RefSeq) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00230  Purine metabolism
kpm00240  Pyrimidine metabolism
kpm01100  Metabolic pathways
kpm03030  DNA replication
kpm03430  Mismatch repair
kpm03440  Homologous recombination
Module
kpm_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KPHS_06810
   00240 Pyrimidine metabolism
    KPHS_06810
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KPHS_06810
   03430 Mismatch repair
    KPHS_06810
   03440 Homologous recombination
    KPHS_06810
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     KPHS_06810
DNA replication proteins [BR:kpm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     KPHS_06810
DNA repair and recombination proteins [BR:kpm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     KPHS_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-GeneID: 11845671
NCBI-ProteinID: YP_005224981
UniProt: A0A0H3GRC3
Position
718355..718768
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAETPPSLTEPLIGDILRA
LAVTPDQVLQLTPDRVAMLPQDSRCNSWRLGTEASLPLAGAQVSTPAFDELQTSAPARRA
LWQQICAHEHDFYPQHG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcaattacagcagctgggcattacccagtggtcgctgcgc
cgaccgggggcgttgcagggcgaaatcgctatctcgcttcctgaacatattcgtctggtg
atggtggcggaaaccccgccgtcgctgacagagccgctgattggcgacatattacgcgcg
ctggccgtgacgccagatcaggtcctgcagctgactccggatcgggtggcgatgctgccg
caggacagccgctgcaacagctggcggttgggcacagaggcgtcgctgccgctggcgggc
gcccaggtgtccacccccgcttttgatgaactccagaccagcgcgccggctcgcagggcg
ctctggcaacaaatctgcgcacatgaacacgatttctaccctcagcacggctga

DBGET integrated database retrieval system