KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_07140Help
Entry
KPHS_07140        CDS       T01733                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00260  Glycine, serine and threonine metabolism
kpm00750  Vitamin B6 metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01230  Biosynthesis of amino acids
Module
kpm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPHS_07140
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KPHS_07140
Enzymes [BR:kpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KPHS_07140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 11845704
NCBI-ProteinID: YP_005225014
UniProt: A0A0H3GMZ2
Position
752865..754145
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDDMLAQDFVTRSAKILS
AFIGDEIPQDVLQQRVRAAFAFPAPVSKVQEDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKATLGLNSANSINISRLLAQICYYFEAAAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRYLQGGEWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDETTKAAMRELKAIGYISEPHAAIAWRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgagcaggtcagctttgcgcaggccgtcacc
cagggacttggcaagcatcagggcctgttctttccgcacgatctgccggaattcagcctg
actgaaatcgacgacatgctggcgcaggactttgtcacccgtagcgccaaaattttatcc
gcctttatcggcgatgagatcccgcaggatgtcctgcagcagcgggtgcgcgcggcgttt
gcgtttccggcgccggtaagcaaggttcaggaagatgtcggctgtctggagctgttccat
ggccctacgctggcgttcaaggatttcggcggccgctttatggcgcagatgctgacccac
atcgcaggcgataagccggtcaccatcctcaccgcgacctctggcgacaccggggcggcg
gtggcgcatgctttctacggcctgccgaacgtcaaggtagtgatcctctatccgcgcggc
aagatcagtccgctgcaggagaagctgttctgtaccctcggcggcaatattgaaaccgtg
gcgattgatggcgactttgatgcctgccaggcgctggtgaagcaggcgtttgacgatgaa
gagctgaaggcgacgctgggtctcaactcggctaactccatcaacatcagccgcctgctg
gcgcagatctgttactacttcgaagcggcggcgcagctgccgcaggaagcccgcaatcag
ctggtgatttccgtgccgagcggcaacttcggcgatctgaccgccggtctgctggccaag
tcgctggggctgccgatcaagcgctttatcgccgccaccaacgccaacgacaccgttccg
cgctatctgcagggcggcgagtgggcgccaaaagccacccaggcgacgctgtccaacgcc
atggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccgccgtaaaatc
tggcgtctcagcgagctgggctatgccgcggtcgatgatgagaccaccaaagcagcgatg
cgcgagctgaaggccatcggctacatctctgaaccgcatgcggcgattgcctggcgcgcg
ctgcgcgatcagctgcagccgggagagtacggcctgttcctcggcaccgcccatccggcg
aagttcaaagagagcgtggaggagatcctgcaggagactctgccgctgccgaaggagctg
gccgaccgcgccgacctgccgctgctgtctcacaacctgccggcggatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system