KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_07570Help
Entry
KPHS_07570        CDS       T01733                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00670  One carbon pool by folate
kpm00790  Folate biosynthesis
kpm01100  Metabolic pathways
Module
kpm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KPHS_07570
   00670 One carbon pool by folate
    KPHS_07570
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KPHS_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 11845747
NCBI-ProteinID: YP_005225057
UniProt: A0A0H3GI29
Structure
PDB: 

Position
798956..799435
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtagatcgcgtcattggtatggaaaacgccatg
ccatggaacctgcctgccgatctcgcctggttcaaacgcaacacgttaaataagccggtg
gtgatggggcgtctgacctgggaatccattgggcgcccattgccggggcgtaaaaatatc
gtgatcagcagcaaacccggcagcgacgatcgcgtgcagtgggtctcctccgtagaagaa
gcaattgccgcctgcggcgatgtggaagagattatggtgatcggcggcggccgggtgtat
gagcagttcctgccgaaagcgcagaagctctacttgacccatattgatgcggaagtggaa
ggcgatacccatttcccggattacgatccggacgaatgggagtcggtgttcagcgagttt
catgacgccgacgcgcagaactcccatagctactgctttgagatcctcgaacgccgttaa

DBGET integrated database retrieval system