KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_09960Help
Entry
KPHS_09960        CDS       T01733                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00020  Citrate cycle (TCA cycle)
kpm00620  Pyruvate metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
Module
kpm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_09960
   00020 Citrate cycle (TCA cycle)
    KPHS_09960
   00620 Pyruvate metabolism
    KPHS_09960
Enzymes [BR:kpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KPHS_09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl SLD3
Motif
Other DBs
NCBI-GeneID: 11845993
NCBI-ProteinID: YP_005225296
UniProt: A0A0H3GSC6
Position
complement(1055756..1057291)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
ILAREGETLQVGAVLALAADASVSDAELDEFVARLATAKPAAPGPEAAAPDVAAQAGAKP
ASVVSPPSNSPEPPVGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGD
RISVSDLESAIVAAGGRLASPTPPVRRSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAAALLLDEHPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLALRQDINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEAAQ
SIRRFTDADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSLSNLGMLGVRQFDAIINPPQSAILAIGAGEVRAVVRDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatatgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggccccctttgccggtacgttacgtcgg
atactcgcccgcgagggtgagacgcttcaggtaggcgccgtgctggccctggcggctgac
gcgtcggtcagcgatgctgaactggacgaatttgttgcccgcctggcgacggcgaaaccc
gcagccccaggcccggaggctgccgcgccggacgtagcggcacaggcaggcgctaagcca
gcttccgttgtttcgccgccatccaacagccccgagccccctgttgggcagaccgtcatc
cccgtcagtctgcaaggtgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
cgactgtctgcccgctggggtgtcgacctgaaaaaagtccgcggcagcgggcgcggggat
cgtatctctgtttctgatctggaaagcgcgatcgttgccgccggcggtcgcctggcctct
ccgacgccccccgttcgtcgcagcaaagcgccccgctcgcatgccgatgacagccaggta
tcggccaccccgctggcgcgccgcctggccggcaaactgggtatcaacttgcatgactgc
cgaagcagcggttcacgcggtcgggtaagtcgcgatgatgtgctggccgcggcgttgtta
ctcgacgagcacccgcagaccagtcctgtgcaggagagtgccccggccccctttgagagc
atcccgatgtccggtatgcggcgggctatcgcttctcgcctgcaaacgtccaagcaacag
tctccccatttccgtttgagcgtcgatctcgatctggagcgactgttagcgttacgtcag
gacattaaccgcgaagtacccggcgtcaagatttcggtgaatgacctgctggtgaaggcc
tgcgccctggcgctggtggccgtgcctgacgtcaatatccagtttgatgaagcggcacaa
agtatccgccgctttacggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgattagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcctgtcaaatctggggatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgaggtccgggcggtagtacgcgac
gggcaaatcgtcgcgcgacagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaaccccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system