KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_10150Help
Entry
KPHS_10150        CDS       T01733                                 

Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00330  Arginine and proline metabolism
kpm00332  Carbapenem biosynthesis
kpm01100  Metabolic pathways
kpm01130  Biosynthesis of antibiotics
kpm01230  Biosynthesis of amino acids
Module
kpm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KPHS_10150
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    KPHS_10150
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     KPHS_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 11846013
NCBI-ProteinID: YP_005225315
UniProt: A0A0H3GK38
Position
complement(1074776..1075879)
Genome map
AA seq 367 aa AA seqDB search
MSESQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAMGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNSIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQPGLFTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGNRPD
VIGHAMAGLPVGTCFHAQESPLENRKRWIFGAPPAGEITVDAGATQAILERGSSLLPKGI
KIVSGNFSRGEVIRIRNSEGRDIAHGVSRYNSDALRLIAGQHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagccagacgctggtggtaaaactgggcaccagtgttttaacaggcgggtcc
cgtcgcctgaaccgcgcccatatcgtcgagcttgtgcgccagtgcgcacagttgcacgcc
atgggacaccgtattgtcatcgtgacctccggggccattgccgccgggcgcgagcacctt
ggttacccggaactgcccgccaccatcgcctccaagcagctgctggcggcggtgggacaa
agccgtctgatccagctgtgggaacagctgttttctatctatggcattcacgttggccag
atgctgctgacccgcgccgacatggaagacagagaacggttcctcaacgcccgcgacact
ctgcgtgcgctgctggataacagcatcgtcccggtcattaacgaaaacgacgccgtcgct
accgcggaaatcaaagtgggcgataacgacaatctctccgcgctggccgcgatcctcgcc
ggggcggataagctgctgctgttaaccgaccagccaggcctgttcaccgccgacccgcgc
agcaacccgcaggcggagctgattaaagacgtttacggcatcgacgacgcgctgcgcgcc
atcgccggcgatagcgtctccggacttggcaccggcggcatgggcaccaagctgcaggcc
gcggacgtcgcctgccgggcggggattgataccatcatcgccgccgggaaccgtccggac
gtcatcggccatgcgatggcaggcctgccggtaggtacctgcttccacgcccaggagtct
ccgctggagaaccgtaagcgctggatcttcggcgcgccgccggcgggggaaatcaccgtc
gatgcgggcgcgacccaggcgatcctcgaaagaggcagctcgctattgccaaaaggcatc
aaaatcgtcagcggcaacttctcccgcggcgaagtgatccgcatccgcaatagcgaagga
cgcgacatcgctcacggcgtcagccgctacaacagcgatgcgctgcgccttatcgccggc
cagcactcgcagcaaatcgatgccattctgggctatgaatacggcccggtggccgtccac
cgcgatgatatgatcatccgttaa

DBGET integrated database retrieval system