KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_15700Help
Entry
KPHS_15700        CDS       T01733                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00020  Citrate cycle (TCA cycle)
kpm00310  Lysine degradation
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
Module
kpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPHS_15700
  Amino acid metabolism
   00310 Lysine degradation
    KPHS_15700
Enzymes [BR:kpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KPHS_15700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-GeneID: 11846578
NCBI-ProteinID: YP_005225870
UniProt: A0A0H3GLJ0
Position
1635336..1636562
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGATVLSRQILGRLREGNSAGKESSEKADAKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDPAAIKGTGVGGRLTREDVEKHLAKAPAPAEAKAPAAAPAAAPAPQLGHRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaaccgtc
gccacctggcacaaaaaaccgggcgacgcggtcgtccgtgacgaagttctggtcgaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcagtg
ctggaagacgagggcgccaccgtcctgtctcgccagatccttggccgcctgcgcgaaggc
aacagcgcaggtaaagaaagcagcgagaaagccgatgcgaaagcgtccactccggcgcag
cgtcagcaggcctctctggaagagcagaacaacgacgcgctgagcccggcgatccgtcgt
ctgctggctgaacacaaccttgacccagcggccatcaaaggcactggcgtcggcggtcgt
ctgacccgcgaagacgttgagaaacatctggcgaaagccccggcgccggcagaagccaaa
gcgccagccgccgccccggcagccgcgccggcgccgcagctgggccaccgttcggaaaaa
cgcgtcccgatgacccgtctgcgtaaacgcgtagccgaacgtctgctggaagcgaaaaac
tctaccgccatgctgacgacctttaacgaagtcaacatgaagcccatcatggatctgcgt
aagcagtacggtgaggcgttcgaaaaacgtcatggcatccgcctgggctttatgtccttc
tacgtgaaagcggtagtggaagcgctgaaacgctatccggaagtgaacgcttccatcgat
ggcgacgacgtggtgtaccacaactacttcgacgtcagcatggccgtatccactccgcgc
ggtctggtcaccccggtgctgcgtgacgtcgacctgctgggcatggcggatatcgaaaag
aatatcaaagagctggcagtgaaaggccgcgacggcaagctgaccgtagacgacctgacc
ggcggtaacttcactattaccaacggcggcgtcttcggctccctgatgtccacgccgatc
atcaacccaccgcagagcgctattctgggtatgcatgccattaaagaccgtccgatggcg
gtcaatggcaaggtagagatcctgccgatgatgtacctggcgctctcctatgaccaccgt
ctgatcgacggacgtgaatcggtaggcttcctggtggcgattaaagagctgctggaagat
ccgacccgtctgctgctggacgtgtag

DBGET integrated database retrieval system