KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_20790Help
Entry
KPHS_20790        CDS       T01733                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_20790
Enzymes [BR:kpm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     KPHS_20790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 11847097
NCBI-ProteinID: YP_005226379
UniProt: A0A0H3GRG2
Position
complement(2131567..2132451)
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVNETISPVISRRQLDDLELIVIDHPQVKASVALQGAHLLSWKPAGEEEVLW
LSNNTPFKQGVALRGGVPICWPWFGPSAQQGLPSHGFARNLPWTLEGHDEDDSGVMLTFA
LQHSAETMKLWPHEFTLYARFKLGKTCEIELEAHGEFETTSALHSYFNVGDIAAVKVSGL
GERYIDKVNNAEEGVLSNGVQTFPDRTDRVYLNADSCSVIHDDALNRTIDVVHHHQHNVV
AWNPGPALSVSMGDMPDDGYKTFVCVETCCVTQPQKASEETPSRLAQTISVKKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaatttttgctctcccggtgaatgaaaccatttctcccgtgatctcccgt
cgccagctggatgacctggagctgattgtcatcgaccatccgcaggtgaaagcctctgtg
gcgctgcagggggcgcacctgctctcctggaaacccgccggtgaagaagaagttctgtgg
ctgagcaacaacaccccgtttaaacagggcgtcgccctgcgcggcggcgtgccgatttgc
tggccctggtttggtccttctgcgcagcaaggtctgccgtcgcacggctttgcccgcaat
ctgccatggaccctggaaggtcatgacgaagacgacagcggcgtaatgttgacctttgcg
ctccagcacagcgctgaaaccatgaagctctggccgcacgagttcaccctctatgcccgc
tttaagctgggcaagacctgtgaaatcgagctggaagcccacggtgaattcgagaccacc
tctgccctgcacagctatttcaacgtcggcgatatcgcggcggtgaaggtgagcggtctt
ggcgagcgctatatcgataaagtgaacaatgccgaagaaggcgttctgagcaacggcgtg
cagaccttccctgaccgcaccgatcgcgtctatctcaacgccgacagctgcagcgtgatc
catgacgacgcgctaaaccgcactatcgacgtggtgcatcatcatcagcacaatgtggtg
gcctggaacccgggcccggcgctgtccgtcagcatgggcgatatgccggacgatggctac
aaaaccttcgtttgcgtcgaaacctgctgcgtaacccagccgcagaaagccagcgaagag
acgccctctcgcctggcgcaaaccatcagcgtgaaaaaacgctaa

DBGET integrated database retrieval system