KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_23020Help
Entry
KPHS_23020        CDS       T01733                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPHS_23020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpm02044]
    KPHS_23020
Secretion system [BR:kpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPHS_23020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP Inhibitor_I24
Motif
Other DBs
NCBI-GeneID: 11847320
NCBI-ProteinID: YP_005226602
UniProt: A0A0H3GMC3
Position
2332062..2332553
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHD
IKNPAYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggcgcggacattaaagggtct
gtcgacgttcaggatcgtgaaggcagtatcgaagtggtggctcaggagcataacctgtac
atcccgaccgataacaacaccggcaaactgaccggcacgcgtattcatacgccgttcctg
ttcaccaaggagatcgactcctccagcccctacctgtacaaggcagtgaccaccggccag
accctgaaatccgctgagttcaagtggtaccgaatcaacgatgccggccaggaagtggag
tatttcaataccaaacttgagaacgtcaaggtggtgaaagtgaatcccctgatgcacgac
atcaaaaaccccgcctacgagaagcacaaccatctggaacagattgagctgcgctacgag
aagatcacctggacctataaagacggcaacatcattcactccgatagctggaacgaacgc
gccaccgcgtaa

DBGET integrated database retrieval system