KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_26810Help
Entry
KPHS_26810        CDS       T01733                                 

Definition
(RefSeq) putative acetylornithine deacetylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00300  Lysine biosynthesis
kpm01100  Metabolic pathways
kpm01120  Microbial metabolism in diverse environments
kpm01230  Biosynthesis of amino acids
Module
kpm_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KPHS_26810
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KPHS_26810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 11847699
NCBI-ProteinID: YP_005226981
UniProt: A0A0H3GXL0
Position
2693983..2695125
Genome map
AA seq 380 aa AA seqDB search
MTATLELARQLLGFNTINPPGSEADCMRFFADWLDDSGFEVSLSSFGEGRCNLIASLPGA
KSGKPLAFTGHLDTVPLGNARWQYDPFGSQMEDGRLYGRGSSDMKAAIAAFAVACVHQRE
AILAGRGAVLLITGGEETGCDGARALIASATLPEVGALIVGEPTANYPVIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTLNVGRIEGGLNINSV
PDRTRFDVDIRSAPNLQHATIRERLTTLLGESVTVSTLVDLPAVLSREDHAWIKQVYQRC
QPLHAEPIAPRVVPYFTDASLLLPALGDPPCIILGPGEPSMAHQTDEYCLLSRLAEAEQL
YGDIIRDWMASPPATKVKNE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacccttgagctcgcccggcagctgctgggctttaacaccatcaacccgccg
ggcagcgaagccgactgcatgcggttcttcgccgactggcttgacgatagcggttttgag
gtttcgctgtcgtcgttcggcgaaggacgctgcaatcttatcgccagcctgcccggggcg
aagagcggtaaaccgctggcctttaccggacatctggataccgtcccgctgggaaatgcc
cgctggcagtacgatcctttcggctcgcagatggaagacgggcgtctttatggccgcgga
tccagcgatatgaaagcggcgatagcggcgtttgccgtcgcctgcgttcatcagcgggaa
gcgatcctcgccggacgcggcgcggtattgctgataaccggcggagaagagaccggctgc
gacggcgcgcgggcgctgatcgcctccgcaacgttgccggaggtgggcgcgctgatcgtc
ggtgaacccaccgccaactatccggttatcggccataaaggcgcgctctggctacgctgc
gaaacgcgggggaaaaccgcccacggcgcgatgccggagctggggatcaatgctatctat
cttgcggcggatgcgttgggtaagattcagcatttttcgccaggcgcgccgcatccgcta
atgaagcaacccaccctcaacgtcggacgcatagaaggcggactcaatattaattccgta
ccggaccgcacgcgttttgatgtcgatatccgcagcgcgcccaatttacagcacgccact
atccgggagcgcttgacgacgctgcttggcgaaagcgtcaccgtctccacgctggtcgac
ctgcccgccgtcctcagccgggaggatcatgcgtggattaagcaggtttatcaacgctgt
cagccgctgcacgctgagccgattgcgccgcgcgtggtgccctactttaccgacgcctcg
ctgctgctgcctgcattgggcgatccgccctgtattattctcggccccggcgagccgtcg
atggcgcatcaaaccgacgaatactgcctgctcagccgactggcggaggccgaacagcta
tacggtgacatcattcgcgactggatggcatcaccgcccgcgacgaaagtaaaaaatgag
tga

DBGET integrated database retrieval system