KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_30330Help
Entry
KPHS_30330        CDS       T01733                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00071  Fatty acid degradation
kpm00072  Synthesis and degradation of ketone bodies
kpm00280  Valine, leucine and isoleucine degradation
kpm00310  Lysine degradation
kpm00362  Benzoate degradation
kpm00380  Tryptophan metabolism
kpm00620  Pyruvate metabolism
kpm00630  Glyoxylate and dicarboxylate metabolism
kpm00640  Propanoate metabolism
kpm00650  Butanoate metabolism
kpm00900  Terpenoid backbone biosynthesis
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
kpm01212  Fatty acid metabolism
kpm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPHS_30330
   00630 Glyoxylate and dicarboxylate metabolism
    KPHS_30330
   00640 Propanoate metabolism
    KPHS_30330
   00650 Butanoate metabolism
    KPHS_30330
  Lipid metabolism
   00071 Fatty acid degradation
    KPHS_30330
   00072 Synthesis and degradation of ketone bodies
    KPHS_30330
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPHS_30330
   00310 Lysine degradation
    KPHS_30330
   00380 Tryptophan metabolism
    KPHS_30330
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPHS_30330
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPHS_30330
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPHS_30330
Enzymes [BR:kpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPHS_30330
Exosome [BR:kpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPHS_30330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 11848054
NCBI-ProteinID: YP_005227333
UniProt: A0A0H3GUM2
Position
3020462..3021211
Genome map
AA seq 249 aa AA seqDB search
MTDIAIVAAVRTPVGSFRGAFAPLSAVDLGAAVVRGLLERCQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREEIVPVSVPQGKKPPRFVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNAS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgcagtacgcaccccggtaggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcggcggtggtgcgcggcctgcttgaacgc
tgccagctgcctgccgcagcggtcgacgaactaattttcggccaggtgcttaccgccggc
tgcgggcagaatccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtgtgcggctccggactgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgatccaggacggcctgtgggacgccttcaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcggcggctgctatcgccgccgggcgctttcgcgaggagatcgtc
ccggtcagcgtcccgcagggcaaaaagccgccgcgattcgtgactgacgatgagcaaccg
cgcccggagaccagcgagcagcagctggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcctcgtag

DBGET integrated database retrieval system