KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_31950Help
Entry
KPHS_31950        CDS       T01733                                 

Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00010  Glycolysis / Gluconeogenesis
kpm00071  Fatty acid degradation
kpm00350  Tyrosine metabolism
kpm00620  Pyruvate metabolism
kpm00625  Chloroalkane and chloroalkene degradation
kpm00626  Naphthalene degradation
kpm00650  Butanoate metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPHS_31950
   00620 Pyruvate metabolism
    KPHS_31950
   00650 Butanoate metabolism
    KPHS_31950
  Lipid metabolism
   00071 Fatty acid degradation
    KPHS_31950
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPHS_31950
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPHS_31950
   00626 Naphthalene degradation
    KPHS_31950
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPHS_31950
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPHS_31950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-GeneID: 11848216
NCBI-ProteinID: YP_005227495
UniProt: A0A0H3GRD3
Position
3180798..3183473
Genome map
AA seq 891 aa AA seqDB search
MAVTNIAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AAKIAELAGFTVPATTKILIGEVTNVDESEPFAHEKLSPTLAMYRAKDFEDAVAKAEKLV
AMGGIGHTSCLYTDQDNQPARVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFVEGEAGAKAEVAPVKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatatcgctgaactgaacgcgcttgttgagcgtgtcaagaaagcccag
cgtgaatatgccagtttcactcaagaacaagtcgacaaaatcttccgcgccgccgctctg
gccgctgcagatgctcgaatccctctcgccaaaatggccgtagccgaatccggcatgggt
atcgttgaagacaaagtgatcaaaaaccacttcgcttccgaatacatttacaacgcttat
aaagacgaaaaaacctgtggcgttctgtcagaagacgacacctttggcaccatcactatt
gctgagcctatcggcatcatctgcggtatcgtaccgaccactaacccgacttcaacagcc
attttcaaatcgctcatcagtctgaaaacgcgtaacgccatcattttctctccgcacccg
cgtgcaaaagaagccaccaacaaagcggctgatatcgtgctgcaggctgccatcgcggcc
ggcgcgccgaaggacctgattggctggatcgatcagccgtctgtagaactgtctaacgcg
ctgatgcatcacccggacatcaacctgatcctggcgaccggtggtccaggcatggtgaaa
gcagcatacagctccggtaaacctgctatcggcgtcggcgccggtaacaccccggtagtc
attgatgaaaccgccgacatcaaacgtgccgtagcgtccgtactgatgtctaaaaccttc
gataacggcgtgatctgtgcttctgagcagtccgttgtggtggttgattcagtctatgac
gcggttcgcgaacgtttcgccagccacggcggctatctgctgcagggtaaagagctgaaa
gccgttcaggacattatcctgaaaaatggcgcgctgaacgcggctatcgttggtcagcca
gcggccaaaatcgctgaactggcaggcttcaccgtgccggccaccaccaaaattctgatt
ggtgaagtgaccaacgttgacgagagcgagccgtttgctcacgaaaaactgtctccgacg
ctggctatgtaccgtgcaaaagatttcgaagacgcggtagccaaagcagaaaaactggtc
gccatgggcggtatcggccacacctcttgcctgtacaccgaccaggacaaccagccggct
cgcgtggcttacttcggccaaatgatgaaaaccgcgcgtatcctgatcaacaccccggct
tctcagggtggtatcggtgacctgtacaacttcaaactcgcgccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctccctgccaatcgcactggatgaagtgattaccgatggtcacaaa
cgcgcgctgatcgtgactgaccgcttcctgttcaacaacggctatgccgatcagatcact
tccgtactgaaagctgcgggtgttgagacggaagtcttcttcgaagttgaagctgacccg
acgctgaccatcgtacgtaaaggtgccgacctggcgaactcctttaaaccagacgtgatc
atcgccctgggcggcggttccccgatggatgcggcgaaaatcatgtgggtcatgtacgaa
catccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggagtcaaagccaagatggtggcgatcactaccacttccggt
accggttctgaagtgacgccgttcgccgtggtgaccgatgacgcgaccggtcagaaatac
ccgctggcagactacgcgctgaccccggatatggccattgtcgatgccaacctggtgatg
gatatgccgaaatcgctgtgtgcgttcggtggtctggatgcggtgactcacgccctggaa
gcttacgtttccgtactggcttctgagttctctgacggccaggcgctgcaggcgctgaaa
ctgctgaaagagtacctgccggcttcctatcacgaaggttccaagaacccggttgcccgt
gagcgcgtacacagtgccgcgactatcgccggtatcgcgttcgctaacgccttcctcggc
gtgtgtcactcgatggcgcacaaactgggttcccagttccatattccgcacggtctggcc
aacgccctgctgatctgcaacgttatccgctataacgcgaatgacaacccgaccaagcag
accgcgttcagccagtacgaccgtccgcaggctcgtcgtcgttacgctgaaatcgccgat
cacctgggcctctccgcaccaggcgaccgcaccgcagcgaaaatcgagaaactgctggca
tggctggaaagcattaaagctgagctgggtattccgaaatctatccgcgaagctggcgtt
caggaagctgacttcctggcccacgttgataaactgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgctacccgctgatctccgaactgaaacagatcctgctggat
acctactacggccgcgaattcgtcgaaggcgaagccggtgcgaaagccgaagttgctccg
gtaaaggctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system