KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_35590Help
Entry
KPHS_35590        CDS       T01733                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00030  Pentose phosphate pathway
kpm00480  Glutathione metabolism
kpm01100  Metabolic pathways
kpm01110  Biosynthesis of secondary metabolites
kpm01120  Microbial metabolism in diverse environments
kpm01130  Biosynthesis of antibiotics
kpm01200  Carbon metabolism
Module
kpm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpm_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPHS_35590
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPHS_35590
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     KPHS_35590
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     KPHS_35590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA Shikimate_DH F420_oxidored 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN
Motif
Other DBs
NCBI-GeneID: 11848590
NCBI-ProteinID: YP_005227859
UniProt: A0A0H3GV88
Structure
PDB: 

Position
complement(3560110..3561516)
Genome map
AA seq 468 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPYYTVQEF
VESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAKTFTEWNEGELSSYLIDITKDIFT
KKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAAS
KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYAQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
FSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWLD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaacagatcggagttgtcggtatggctgtgatggggcgtaacctagcgctg
aacatcgaaagccgaggttataccgtctccgttttcaaccgctcccgtgaaaagaccgaa
gaagttattgccgaaaatccaggcaagaaattggttccttactacacagtacaagagttt
gttgaatctctcgaaacaccacgtcgtatcctgttgatggtgaaggccggtgctggcacc
gacagcgccatcgattccctgaagccttacctcgacaaaggcgacatcatcattgatggc
ggtaacaccttcttccaggacaccatccgtcgtaaccgtgagctgtctgctgaaggtttc
aactttatcggtaccggtgtttccggtggtgaagagggggctctgaaaggaccttccatc
atgcctggtgggcagaaagaagcctatgagttagttgctccaattctgaagcagatcgcg
gcggttgcagaagacggtgagccatgtgtgacctatatcggtgctgacggtgctggccat
tatgtgaagatggttcataacggcatcgagtatggtgacatgcagctgattgccgaagct
tatgcgctgttgaaaggcggtcttgcactttccaacgaagagctggcgaaaacttttacc
gaatggaatgaaggtgagctaagcagctacctgatcgacattaccaaagatatcttcacc
aagaaggatgaagaaggtaagtacctcgttgatgtcattcttgatgaagcagcaaacaaa
ggtaccggtaagtggaccagccagagttcactggatctcggcgaacctctgtctctgatc
accgagtccgtgtttgctcgctatatttcttcgcttaaagaccagcgtgtagccgcttcg
aaagtgctgagtggtccgcaggcccagccggccggtgataaagctgaatttatcgaaaaa
gtgcgtcgcgcgttgtacctcggtaaaatcgtctcctatgctcagggcttctcccagctg
cgtgctgcttctgatgaatacaactgggatcttaactacggcgagatcgctaagattttc
cgcgctggctgcatcattcgtgcgcagttcctgcaaaagatcaccgatgcttatgcgcaa
aatgctggcattgctaaccttttgctggcgccgtacttcaaacagatcgctgatgactat
cagcaggcgctgcgtgatgtcgtggcctatgccgtgcagaatggtattccggtaccgacg
ttctctgccgcaattgcctattacgacagctatcgttccgcagttctgccagctaacctg
attcaggctcagcgcgattactttggtgcgcacacctataagcgtaccgataaggaaggc
gttttccacactgagtggttagattaa

DBGET integrated database retrieval system