KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_35740Help
Entry
KPHS_35740        CDS       T01733                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00040  Pentose and glucuronate interconversions
kpm00052  Galactose metabolism
kpm00500  Starch and sucrose metabolism
kpm00520  Amino sugar and nucleotide sugar metabolism
kpm01100  Metabolic pathways
kpm01130  Biosynthesis of antibiotics
Module
kpm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPHS_35740
   00052 Galactose metabolism
    KPHS_35740
   00500 Starch and sucrose metabolism
    KPHS_35740
   00520 Amino sugar and nucleotide sugar metabolism
    KPHS_35740
Enzymes [BR:kpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KPHS_35740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-GeneID: 11848605
NCBI-ProteinID: YP_005227874
UniProt: A0A0H3GV99
Position
complement(3580878..3581852)
Genome map
AA seq 324 aa AA seqDB search
MNMANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHS
SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCAR
PVVGDNPFVVVLPDIILDGGTADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQ
TKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQL
TDAIAELAKKPSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGTKFRESIKKNAGLT
AGVKMSGRAEPFGTPLITLCRNYS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcgaatttgaaagcggttattccggtcgcaggactaggcatgcatatgctg
ccggccacaaaggcaattccaaaggagatgctgccgatcgttgataagccaatgattcag
tacatcgttgacgaaatcgtcgccgccgggatcaaagagattgttctggtgacgcactcc
tcgaagaacgcggtggaaaaccacttcgacacatcctacgagctggaagccctgctggaa
cagcgcgtgaagcgccagctgctggcggaagtgcaggccatttgcccgccgggcgtgacc
atcatgaacgtgcgtcaggcgcagccgctgggcctgggccactccatcctctgcgcccgc
ccggtagtcggcgacaacccgtttgtggtggtcctgccggatatcatccttgacggcggc
accgctgacccgctgcgctataacctcgccgctatgatcgcccgctttaacgagaccggc
cgcagccaggtgctggcgaaacgcatgccgggcgatctttccgaatactccgtcatccag
accaaagagccgatggtggctgaaggccaggtggcgcgtatcgtcgagtttattgaaaaa
ccggacgagccgcagactctggactccgatctgatggcggtggggcgctacgtgctgtcg
gcggatatctgggccgaactggaacgtaccgagccgggcgcatggggccgtatccagctg
actgacgccattgccgaactggcgaagaagccgtccgtcgacgcgatgctgatgaccggc
gaaagctacgactgcgggaagaaaatgggctacatgcaggccttcgtcacctacggcatg
cgtaacctgaaagaaggcaccaaattccgcgaaagtattaaaaaaaatgctggcctgaca
gctggcgtaaagatgagcggcagggcagagcctttcggcacgccgctcataacgttatgc
agaaattattcataa

DBGET integrated database retrieval system