KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_36230Help
Entry
KPHS_36230        CDS       T01733                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00450  Selenocompound metabolism
kpm00970  Aminoacyl-tRNA biosynthesis
kpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KPHS_36230
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KPHS_36230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpm01007]
    KPHS_36230
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpm03016]
    KPHS_36230
Enzymes [BR:kpm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KPHS_36230
Amino acid related enzymes [BR:kpm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KPHS_36230
Transfer RNA biogenesis [BR:kpm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KPHS_36230
 Prokaryotic type
   Other AARSs
    KPHS_36230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 11848654
NCBI-ProteinID: YP_005227923
UniProt: A0A0H3GVZ1
Position
3638887..3640800
Genome map
AA seq 637 aa AA seqDB search
MRGHEVNFICADDAHGTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGFDISYDNYHSTHS
DENRELSELIYTRLKENGFIKNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCE
VCGATYSPTELIDPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQ
EWFESGLQQWDISRDAPYFGFEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDE
YWKKDSTAELYHFIGKDIVYFHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGT
FIKASTWLNHFDADSLRYYYTAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGF
ISKRFNGVLAAELADPALYKTFTDAAESIGEAWDSREFGKAIREIMALADVANRYVDEQA
PWVVAKQEGRDADLQAICTMGLNMFRVLMTWLKPVLPQLAARAEAFLNSELSWDAIQQPL
LAHKVNPFKALYNRIEMKQVEALVEASKEEVKATAAPVTGPLADDPIQETITFDDFAKVD
LRVALIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIRSAYPDPQPLIGRLTVMVANLAPR
KMRFGISEGMVMAAGPGGKDIFLLSPDDGAKPGQQVK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggccacgaggtcaacttcatctgcgccgacgacgcccacggcacgccgattatg
ctcaaagcgcagcagctcggtatcactccggagcagatgattggcgaaatgagtcaggag
catcagaccgatttcgccggcttcgacatcagctatgataattatcactcgacgcacagc
gacgagaaccgcgagctgtcggagcttatctacacccgcctgaaagagaacggttttatt
aaaaaccgcaccatctctcagctctacgatccggaaaaaggcatgttcctgccggaccgt
tttgtgaaaggcacctgtccgaagtgcaaatctccggaccagtatggcgataactgcgaa
gtgtgcggcgcgacctacagccctaccgagcttatcgacccgaaatcggtggtctccggc
gccacgccggtgatgcgtgactccgagcactttttcttcgacctgccgtcgttcagcgaa
atgctgcaggcgtggacccgcagcggcgccctgcaggagcaggtcgcgaacaagatgcag
gagtggttcgaatccggcctgcagcagtgggacatctcccgcgatgcgccgtacttcggc
ttcgaaattcccaacgcgccgggcaaatatttctacgtctggctggacgcgccgatcggt
tacatgggttccttcaagaacctgtgcgacaagcgcggcgacaccaccagcttcgacgaa
tactggaagaaagattccacggccgagctgtatcactttatcggcaaagacattgtctac
ttccacagcctgttctggccggcgatgctggaaggcagcaacttccgtaagccgactaat
ctgttcgtgcacggctacgtgacggttaacggcgccaagatgtccaagtcgcgcggcacc
tttatcaaggccagcacctggttaaatcatttcgatgccgacagcctgcgctactactac
accgccaagctctcttcacgcatcgatgacatcgacctgaacctggaagatttcgtgcag
cgcgtcaacgccgacatcgtcaacaaggtggttaacctcgcctcgcgcaacgccggcttt
atcagcaagcgtttcaacggcgtgctggccgctgagctggccgacccggcgctgtacaaa
accttcaccgacgcggcggaaagcatcggcgaagcatgggacagccgcgagttcggtaag
gccatccgcgaaatcatggccctcgccgacgtggctaaccgctacgtcgacgagcaggcg
ccgtgggtggtggcgaaacaggaaggccgcgacgccgacctgcaggccatctgcaccatg
ggcctgaatatgttccgcgtgctgatgacctggctgaagccggtcctgccgcagctggcc
gcgcgtgcggaagcgttcctcaacagcgaactgagctgggacgccattcagcagccgctg
ctggcgcataaggtcaatccgttcaaggcgctgtacaaccgtatcgagatgaagcaggtg
gaagccctggtagaagcctctaaagaagaggtgaaagccaccgcggcgccggtcaccggt
ccgctggcggacgatccgattcaggagaccatcacctttgacgatttcgccaaagtcgat
ctgcgcgtggcgctgattgaaaacgcggaattcgtcgagggctccgacaagctactgcgc
ctgacgctggatctcggcggcgaaaaacgtaacgtcttctccggcatccgctccgcctat
ccggatccgcagccgctgattggtcgcctgacggtgatggtcgccaacctggcgccgcgc
aaaatgcgcttcggcatctccgagggcatggtgatggccgccggccctggcgggaaggat
atcttcctgttaagccctgacgacggcgccaagccgggtcagcaggtgaaataa

DBGET integrated database retrieval system